Conserved Protein Domain Family
PRK12438

?
PRK12438: PRK12438 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 171499
View PSSM: PRK12438
Aligned: 12 rows
Threshold Bit Score: 1809.45
Threshold Setting Gi: 54026499
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
226365859   1 MGMRPPAGLPSLSKRSRVLLVLALVVAALLLVGPRLISTYTDWLWFGEVGFRGVFTTVLVTRLLLFLVVGVVVGGIVWLA 80  
15607206    1 METGSPGKRPVLPKRARLLVTAGMGMLALLLFGPRLVDIYVDWLWFGEVGFRSVWITVLLTRLAIVAAVALVVAGIVLAA 80  
111025452   1 --MQPSDRMRALPRRARVMIMVTVALIALLVIGPRLVVGYTDWLWFGEVGYRRVWGTVLVTRLILFTAVTLLVGAVIFAA 78  
15839443    1 METGSPGKRPVLPKRARLLVTAGMGMLALLLFGPRLVDIYVDWLWFGEVGFRSVWITVLLTRLAIVAAVALVVAGIVLAA 80  
31791241    1 METGSPGKRPVLPKRARLLVTAGMGMLALLLFGPRLVDIYVDWLWFGEVGFRSVWITVLLTRLAIVAAVALVVAGIVLAA 80  
121635974   1 METGSPGKRPVLPKRARLLVTAGMGMLALLLFGPRLVDIYVDWLWFGEVGFRSVWITVLLTRLAIVAAVALVVAGIVLAA 80  
148659824   1 METGSPGKRPVLPKRARLLVTAGMGMLALLLFGPRLVDIYVDWLWFGEVGFRSVWITVLLTRLAIVAAVALVVAGIVLAA 80  
54026499    1 MGMRPPSGLPSLSRRSRVLLVAAVVLAALLLLGPRFTDAYTNWLWFGEVGFREVFLTVVVTRIILFAAVALFVGATVWLA 80  
111023352   1 MGMRPPAGLPSLSKRSRVLLVLALVVAALLLVGPRLISTYTDWLWFGEVGFRGVFTTVLITRLLLFLVVGVVVGGIVWLA 80  
224988447   1 METGSPGKRPVLPKRARLLVTAGMGMLALLLFGPRLVDIYVDWLWFGEVGFRSVWITVLLTRLAIVAAVALVVAGIVLAA 80  
226305718   1 --MRPPAGLPSLSRRSRILLVVAVVVAALLLVGPRLIGMYTDWLWFGEVGYRGVFTKVLLTRFVLFLVVGIVVGAIVWLA 78  
253796980   1 METGSPGKRPVLPKRARLLVTAGMGMLALLLFGPRLVDIYVDWLWFGEVGFRSVWITVLLTRLAIVAAVALVVAGIVLAA 80  
226365859  81 LLLAYRSRPVFVP--VSGPNDPVARYRTTVMTRLRLFGLAIPIAVGLLAGLIAQSSWVTVQLFVNGGSFGVADPEFGLDV 158 
15607206   81 LLLAYRSRPFFVP--DEPQRDPVAPLRSAVMRRPRLFGWGIAVTLGVVCGLIASFDWVKVQLFVHGGTFGIVDPEFGYDI 158 
111025452  79 VVWAYRSRPLFAAsgANTAKDPVERYREVVSRRPRSFTVGIALLLALPFGLHAQASWETVQLFLHGGAFGTVDAEFGYDI 158 
15839443   81 LLLAYRSRPFFVP--DEPQRDPVAPLRSAVMRRPRLFGWGIAVTLGVVCGLIASFDWVKVQLFVHGGTFGIVDPEFGYDI 158 
31791241   81 LLLAYRSRPFFVP--DEPQRDPVAPLRSAVMRRPRLFGWGIAVTLGVVCGLIASFDWVKVQLFVHGGTFGIVDPEFGYDI 158 
121635974  81 LLLAYRSRPFFVP--DEPQRDPVAPLRSAVMRRPRLFGWGIAVTLGVVCGLIASFDWVKVQLFVHGGTFGIVDPEFGYDI 158 
148659824  81 LLLAYRSRPFFVP--DEPQRDPVAPLRSAVMRRPRLFGWGIAVTLGVVCGLIASFDWVKVQLFVHGGTFGIVDPEFGYDI 158 
54026499   81 LLLAYRTRPVFVP--MAGPNDPIARYRTTVMSRLKTFGIGIPVLLGLLAGLVAQSNWVTVQLFLNGGDFGEQDPQFHLDV 158 
111023352  81 LLLAYRSRPVFVP--VSGPNDPVARYRTTVMTRLRLFGLAIPIAVGLLAGLIAQSSWVTVQLFVNGGAFGVADPEFGLDV 158 
224988447  81 LLLAYRSRPFFVP--DEPQRDPVAPLRSAVMRRPRLFGWGIAVTLGVVCGLIASFDWVKVQLFVHGGTFGIVDPEFGYDI 158 
226305718  79 MLLAYRARPVFVP--VSGPNDPIARYRTTVMSRLRLFGVIIPVAIGILSGLIAQANWVTIQLFLNGQPFGITDPQFNLDV 156 
253796980  81 LLLAYRSRPFFVP--DEPQRDPVAPLRSAVMRRPRLFGWGIAVTLGVVCGLIASFDWVKVQLFVHGGTFGIVDPEFGYDI 158 
226365859 159 GFYTFDLPFYRFVLNWLFVAVLLAFFASLVTHYIFGGLKLAGRGG---ALTNAARVQLAVLAGTFILLKAVAYWFDRYSL 235 
15607206  159 GFFVFDLPFYRSVLNWLFVAVVLAFLASLLTHYLFGGLRLTTGRG---MLTQAARVQLAVFAGAVVLLKAVAYWLDRYEL 235 
111025452 159 GFYVFDLPFYRLILAWLFIAVFLALLIGLGTHYLFGGIRLAPSKDhviEVSRPARVQLAVFAGTFIALKAASYWLDRYSL 238 
15839443  159 GFFVFDLPFYRSVLNWLFVAVVLAFLASLLTHYLFGGLRLTTGRG---MLTQAARVQLAVFAGAVVLLKAVAYWLDRYEL 235 
31791241  159 GFFVFDLPFYRSVLNWLFVAVVLAFLASLLTHYLFGGLRLTTGRG---MLTQAARVQLAVFAGAVVLLKAVAYWLDRYEL 235 
121635974 159 GFFVFDLPFYRSVLNWLFVAVVLAFLASLLTHYLFGGLRLTTGRG---MLTQAARVQLAVFAGAVVLLKAVAYWLDRYEL 235 
148659824 159 GFFVFDLPFYRSVLNWLFVAVVLAFLASLLTHYLFGGLRLTTGRG---MLTQAARVQLAVFAGAVVLLKAVAYWLDRYEL 235 
54026499  159 GFYAFDLPFYRMVLNWMFVAVVIAFFASLVTHYIFGGLRLSGREG---TLTRPARIQLAVIAGLFVLLKAVAYWFDRYDL 235 
111023352 159 GFYTFDLPFYRFVLNWLFVAVLLAFFASLVTHYIFGGLKLAGRGG---ALTNAARVQLAVLAGTFILLKAVAYWFDRYSL 235 
224988447 159 GFFVFDLPFYRSVLNWLFVAVVLAFLASLLTHYLFGGLRLTTGRG---MLTQAARVQLAVFAGAVVLLKAVAYWLDRYEL 235 
226305718 157 GFYTFDLPFYRFVLNWLFVSILLAFVANLVTHYVFGGIKLAGRAG---TFTTAARVQLAVIAGTFVLLKAVAYWFDRYSL 233 
253796980 159 GFFVFDLPFYRSVLNWLFVAVVLAFLASLLTHYLFGGLRLTTGRG---MLTQAARVQLAVFAGAVVLLKAVAYWLDRYEL 235 
226365859 236 LSSSRKEPTFTGGSYTDMNAVLQAKLILLAIAVICAGAFFAAIFLRDLRIPAMATALLVLSSILVGAVWPLVVEQFSVRP 315 
15607206  236 LSSGRKEPTFTGAGYTDIHAELPAKLVLVAIAVLCAVSFFTAIFLRDLRIPAMAAALLVLSAILVGGLWPLLMEQFSVRP 315 
111025452 239 LWSGRKEPTFTGAGYTDINAVLPARLIMVAIAVLCAVAFFAAIAVRDLRIPAMATALLVLSAILVGGIYPALIEQFSVRP 318 
15839443  236 LSSGRKEPTFTGAGYTDIHAELPAKLVLVAIAVLCAVSFFTAIFLRDLRIPAMAAALLVLSAILVGGLWPLLMEQFSVRP 315 
31791241  236 LSSGRKEPTFTGAGYTDIHAELPAKLVLVAIAVLCAVSFFTAIFLRDLRIPAMAAALLVLSAILVGGLWPLLMEQFSVRP 315 
121635974 236 LSSGRKEPTFTGAGYTDIHAELPAKLVLVAIAVLCAVSFFTAIFLRDLRIPAMAAALLVLSAILVGGLWPLLMEQFSVRP 315 
148659824 236 LSSGRKEPTFTGAGYTDIHAELPAKLVLVAIAVLCAVSFFTAIFLRDLRIPAMAAALLVLSAILVGGLWPLLMEQFSVRP 315 
54026499  236 LSSSRKEPTFYGGSFTDINAVLPAKLILLAIAVICAVAFFAGVVLRDLRVPAMAAALLVLSSVLVGAVYPLVVEQFSVRP 315 
111023352 236 LSSSRKEPTFTGGSYTDMNAVLQAKLILLAIAVICAGAFFAAIFLRDLRIPAMATALLVLSSILVGAVWPLVVEQFSVRP 315 
224988447 236 LSSGRKEPTFTGAGYTDIHAELPAKLVLVAIAVLCAVSFFTAIFLRDLRIPAMAAALLVLSAILVGGLWPLLMEQFSVRP 315 
226305718 234 MSSSRKEPTFTGPGFTDINAVLPAKLILLSIAVICALAFFASIFTRDLRIPAMAVALLVLSSVLVGAVYPMIVEQFSVKP 313 
253796980 236 LSSGRKEPTFTGAGYTDIHAELPAKLVLVAIAVLCAVSFFTAIFLRDLRIPAMAAALLVLSAILVGGLWPLLMEQFSVRP 315 
226365859 316 NAADKESAYIERNIAATRQAYGITDDKVEYQDYQGYGTTPPRDVPADVTTIANTRLLDPNILSRTFTQQQQLKNFYGFPP 395 
15607206  316 NAADVERPYIQRNIEATREAYRIGGDWVQYRSYPGIGTKQPRDVPVDVTTIAKVRLLDPHILSRTFTQQQQLKNFFSFAE 395 
111025452 319 NAADRESPYIERNIAATRQAYGIGPDRVDYLDYPGVGTRSPRDIPADVTTIANARLLDPTVLSRTFTQQQQLKNFYGFPE 398 
15839443  316 NAADVERPYIQRNIEATREAYRIGGDWVQYRSYPGIGTKQPRDVPVDVTTIAKVRLLDPHILSRTFTQQQQLKNFFSFAE 395 
31791241  316 NAADVERPYIQRNIEATREAYRIGGDWVQYRSYPGIGTKQPRDVPVDVTTIAKVRLLDPHILSRTFTQQQQLKNFFSFAE 395 
121635974 316 NAADVERPYIQRNIEATREAYRIGGDWVQYRSYPGIGTKQPRDVPVDVTTIAKVRLLDPHILSRTFTQQQQLKNFFSFAE 395 
148659824 316 NAADVERPYIQRNIEATREAYRIGGDWVQYRSYPGIGTKQPRDVPVDVTTIAKVRLLDPHILSRTFTQQQQLKNFFSFAE 395 
54026499  316 NAADKESEYIERNIAATRQAFGITSDKIEYKDYKGESDKNPLDVPVDAATIGNARLLDPNILSPTFTQLRQLKNFYGFPE 395 
111023352 316 NAADKESAYIERNIAATRQAYGITDDKVEYQDYQGYGTKPPRDVPADVMTIENTRLLDPNILSRTFTQQQQLKNFYGFPP 395 
224988447 316 NAADVERPYIQRNIEATREAYRIGGDWVQYRSYPGIGTKQPRDVPVDVTTIAKVRLLDPHILSRTFTQQQQLKNFFSFAE 395 
226305718 314 NAAQKESTYIERNIEATRQAYGITEENVDYVDYPGVGTKQPQDVPADRTTIANTRLLDPTILSPTFTAQRQLKNFYGFPQ 393 
253796980 316 NAADVERPYIQRNIEATREAYRIGGDWVQYRSYPGIGTKQPRDVPVDVTTIAKVRLLDPHILSRTFTQQQQLKNFFSFAE 395 
226365859 396 TLDIDRYDIDGEMRDYIVAARELSSKSLTGNQTDWINKHTVYTHGNGLVAAPANRVNAAAGESaEEAANSNSGYPVYMVS 475 
15607206  396 ILDIDRYRIDGELQDYIVGVRELSPKSLTGNQTDWINKHTVYTHGNGFVAAPANRVNAAARGA-ENISDSNSGYPIYAVS 474 
111025452 399 HLNIDRYTIDGQLTDYIVAARELSPNSLSGNQTQWINRHTVYTHGNGFIAAPANRVNAAVRDVaGQSASSDSGYPIYAVS 478 
15839443  396 ILDIDRYRIDGELQDYIVGVREFSPKSLTGNQTDWINKHTVYTHGNGFVAAPANRVNAAARDA-ENISDSNSGYPIYAVS 474 
31791241  396 ILDIDRYRIDGELQDYIVGVRELSPKSLTGNQTDWINKHIVYTHGNGFVAAPANRVNAAARDA-ENISDSNSGYPIYAVS 474 
121635974 396 ILDIDRYRIDGELQDYIVGVRELSPKSLTGNQTDWINKHTVYTHGNGFVAAPANRVNAAARDA-ENISDSNSGYPIYAVS 474 
148659824 396 ILDIDRYRIDGELQDYIVGVRELSPKSLTGNQTDWINKHTVYTHGNGFVAAPANRVNAAARDA-ENISDSNSGYPIYAVS 474 
54026499  396 SLDIDRYNLDGNLQDYIVAARELSPAALTGNQTDWINKHTVYTHGNGFVAAPANRVNKPQSEDvAAGGSSDSGYPIFLVS 475 
111023352 396 TLDIDRYDIDGQLRDYIVAARELSSKSLTGNQTDWINKHTVYTHGNGLVAAPANRVNAAAGESaEEAANSNSGYPVYMVS 475 
224988447 396 ILDIDRYRIDGELQDYIVGVRELSPKSLTGNQTDWINKHTVYTHGNGFVAAPANRVNAAARDA-ENISDSNSGYPIYAVS 474 
226305718 394 TLNVDRYEQDGQLRDFVVAARELSPNNLSGNQTDWINKHTVYTHGNGFVAAQANEVTAVQGDS----QNNTGGYPIYSVS 469 
253796980 396 ILDIDRYRIDGELQDYIVGVRELSPKSLTGNQTDWINKHTVYTHGNGFVAAPANRVNAAARDA-ENISDSNSGYPIYAVS 474 
226365859 476 DIASQAAGDQVIPVEQPRIYYGEVIADTDADYAIVGGSEGSDPREYDTDTSRYTYTGSGGVPIGNWFNRLAFAAKYTERN 555 
15607206  475 DIASLGSGRQVIPVEQPRVYYGEVIAQADPDYAIVGGAPGSAPREYDTDTSKYTYTGAGGVSIGNWFNRTVFATKVAQHK 554 
111025452 479 DIASQVGGDQVIPVEQPRIYFGEVIAQADPDYAIVGGPEGVPPREYDTDTAQYTYTGTGGVPVGSWVNRLAFAARYGERN 558 
15839443  475 DIASLGSGRQVIPVEQPRVYYGEVIAQADPDYAIVGGAPGSAPREYDTDTSKYTYTGAGGVSIGNWFNRTVFATKVAQHK 554 
31791241  475 DIASLGSGRQVIPVEQPRVYYGEVIAQADPDYAIVGGAPGSAPREYDTDTSKYTYTGAGGVSIGNWFNRTVFATKFAQHK 554 
121635974 475 DIASLGSGRQVIPVEQPRVYYGEVIAQADPDYAIVGGAPGSAPREYDTDTSKYTYTGAGGVSIGNWFNRTVFATKFAQHK 554 
148659824 475 DIASLGSGRQVIPVEQPRVYYGEVIAQADPDYAIVGGAPGSAPREYDTDTSKYTYTGAGGVSIGNWFNRTVFATKVAQHK 554 
54026499  476 DLFT-PKDRQRIPVEQPRIYFGELISQSDPDYAIVGGAEGQAPREYDSDTAQYTYTGKGGVPIGNWFNRLAFAAKYAERN 554 
111023352 476 DIASQEAGNQVIPVQQPRIYYGEVIADTDADYAIVGGSGGSDPREYDTDTSRYTYTGSGGVPIGNWFNRLAFAAKYTERN 555 
224988447 475 DIASLGSGRQVIPVEQPRVYYGEVIAQADPDYAIVGGAPGSAPREYDTDTSKYTYTGAGGVSIGNWFNRTVFATKFAQHK 554 
226305718 470 DLTT-TPENENLKVDNPRSYYGEVISQSDADYSIVGSVDGEGPREYDTDTSKYTYTGSGGVSIGNWFNRLAFAAKYTERN 548 
253796980 475 DIASLGSGRQVIPVEQPRVYYGEVIAQADPDYAIVGGAPGSAPREYDTDTSKYTYTGAGGVSIGNWFNRTVFATKVAQHK 554 
226365859 556 ILFSGAIGSDSKIIYNRDPRDRVTHVAPWLTADGDSYPAVVDGKVVWIVDAYTTLQDYPYAQRSSLDGlvedSIDQNTGR 635 
15607206  555 FLFSREIGSESKVLIHRDPKERVQRVAPWLTTDDNPYPVVVNGRIVWIVDAYTTLDTYPYAQRSSLEG----PVTSPTGI 630 
111025452 559 ILFSGAIGSESKIIFNRDPAARVEHVAPWLTTDSNPYPAVVGGRIVWIVDGYTTAAHYPYSQVGSLAE----PVVNDTGR 634 
15839443  555 FLFSREIGSESKVLIHRDPKERVQRVAPWLTTDDNPYPVVVNGRIVWIVDAYTTLDTYPYAQRSSLEG----PVTSPTGI 630 
31791241  555 FLFSREIGSESKVLIHRDPKERVQRVAPWLTTDDNPYPVVVNGRIVWIVDAYTTLDTYPYAQRSSLEG----PVTSPTGI 630 
121635974 555 FLFSREIGSESKVLIHRDPKERVQRVAPWLTTDDNPYPVVVNGRIVWIVDAYTTLDTYPYAQRSSLEG----PVTSPTGI 630 
148659824 555 FLFSREIGSESKVLIHRDPKERVQRVAPWLTTDDNPYPVVVNGRIVWIVDAYTTLDTYPYAQRSSLEG----PVTSPTGI 630 
54026499  555 ILFSSAIGDDSKIIFNRSPRERVQKVAPWLTTDGNAYPAVVDERIVWIVDAYTTLDNYPYAQKTSLEGavedSIDKKTGR 634 
111023352 556 ILFSGAIGSDSKIIYNRDPRDRVTHVAPWLTADGDSYPAVVDGKVVWIVDAYTTLQDYPYAQRSSLDGlvedSIDQNTGR 635 
224988447 555 FLFSREIGSESKVLIHRDPKERVQRVAPWLTTDDNPYPVVVNGRIVWIVDAYTTLDTYPYAQRSSLEG----PVTSPTGI 630 
226305718 549 ILFSSAIGSNSKIIFKRDPKERVEEVAPWLTTDGAAYPAVVDGKMQWIIDGYTTAQDYPYAQRSSLDGlvedSIDQTTGR 628 
253796980 555 FLFSREIGSESKVLIHRDPKERVQRVAPWLTTDDNPYPVVVNGRIVWIVDAYTTLDTYPYAQRSSLEG----PVTSPTGI 630 
226365859 636 LLPRKEVSYIRNSVKATVDAYDGTVKLYQVDQNDPVLDAWMGVFPDAVQPADSIPDELRAHFRYPEDLFKVQREMLAKYH 715 
15607206  631 VRQGKQVSYVRNSVKATVDAYDGTVTLFQFDRDDPVLRTWMRAFPGTVKSEDQIPDELRAHFRYPEDLFEVQRSLLAKYH 710 
111025452 635 TLAREEVSYVRNSVKATVDAYDGTVTLYQVDENDPVLGAWMKVFPGTVQPPTAIPTELRAHFRYPEDLFRLQRDLLAKYH 714 
15839443  631 VRQGKQVSYVRNSVKATVDAYDGTVTLFQFDRDDPVLRTWMRAFPGTVKSEDQIPDELRAHFRYPEDLFEVQRSLLAKYH 710 
31791241  631 VRQGKQVSYVRNSVKATVDAYDGTVTLFQFDRDDPVLRTWMRAFPGTVKSEDQIPDELRAHFRYPEDLFEVQRSLLAKYH 710 
121635974 631 VRQGKQVSYVRNSVKATVDAYDGTVTLFQFDRDDPVLRTWMRAFPGTVKSEDQIPDELRAHFRYPEDLFEVQRSLLAKYH 710 
148659824 631 VRQGKQVSYVRNSVKATVDAYDGTVTLFQFDRDDPVLRTWMRAFPGTVKSEDQIPDELRAHFRYPEDLFEVQRSLLAKYH 710 
54026499  635 LLPRKEVSYIRNSVKATVDAYDGTVTLYEVDSTDPVLKAWRGVFPGAVKPESEISPELRAHFRYPEDLFKVQREMLTKYH 714 
111023352 636 LLPRKEVSYIRNSVKATVDAYDGTVKLYQVDQNDPVLDAWMGVFPDAVQPADSIPDELRAHFRYPEDLFKVQREMLAKYH 715 
224988447 631 VRQGKQVSYVRNSVKATVDAYDGTVTLFQFDRDDPVLRTWMRAFPGTVKSEDQIPDELRAHFRYPEDLFEVQRSLLAKYH 710 
226305718 629 LIPRQEFSYIRNSVKATVDAYDGTVTLYQVDEQDPVLKAWMGVFPNTVKPKSEISDDLQAHFRYPEDMFKVQREMLAKYH 708 
253796980 631 VRQGKQVSYVRNSVKATVDAYDGTVTLFQFDRDDPVLRTWMRAFPGTVKSEDQIPDELRAHFRYPEDLFEVQRSLLAKYH 710 
226365859 716 VDDPKEFFTNNAFWSVPSDPTIDTSA-NQPPYYVLVGDPETGKPSFNLTSAMVGYSREFLSAYLSVKSDPENYGKFTVLQ 794 
15607206  711 VDEPREFFTTNAFWSVPSDPTNNANA-TQPPFYVLVGDQQSAQPSFRLASAMVGYNREFLSAYISAHSDPANYGKLTVLE 789 
111025452 715 VDDPREFFTTNAFWSVPSDPTADTGG-EQPPYYVLVGDAGTAAPSFRLTSAMVGFNREFLSAYLSAHSDPENYGRIDILR 793 
15839443  711 VDEPREFFTTNAFWSVPSDPTNDANA-TQPPFYVLVGDQQSAQPSFRLASAMVGYNREFLSAYISAHSDPANYGKLTVLE 789 
31791241  711 VDEPREFFTTNAFWSVPSDPTNDANA-TQPPFYVLVGDQQSAQPSFRLASAMVGYNREFLSAYISAHSDPANYGKLTVLE 789 
121635974 711 VDEPREFFTTNAFWSVPSDPTNDANA-TQPPFYVLVGDQQSAQPSFRLASAMVGYNREFLSAYISAHSDPANYGKLTVLE 789 
148659824 711 VDEPREFFTTNAFWSVPSDPTNNANA-TQPPFYVLVGDQQSAQPSFRLASAMVGYNREFLSAYISAHSDPANYGKLTVLE 789 
54026499  715 VDNPREFFTNNAFWSVPSDPTIEGGSfNQPPYYVLLGDPKTNRPVFNLTSAMVGYNRQFLSAYISVRSDPDDYGKFTILR 794 
111023352 716 VDDPKEFFTNNAFWSVPSDPTIDTSA-NQPPYYVLVGDPETGKPSFNLTSAMVGYSREFLSAYLSVKSDPENYGKFTVLQ 794 
224988447 711 VDEPREFFTTNAFWSVPSDPTNDANA-TQPPFYVLVGDQQSAQPSFRLASAMVGYNREFLSAYISAHSDPANYGKLTVLE 789 
226305718 709 VDDPSEFFTNNAFWSVPSDPTIDTSA-NQPPYYVLVGDKDTAKADFRLTSPMVGFSRELLSAYISVANDKENYGKFTVLQ 787 
253796980 711 VDEPREFFTTNAFWSVPSDPTNDANA-TQPPFYVLVGDQQSAQPSFRLASAMVGYNREFLSAYISAHSDPANYGKLTVLE 789 
226365859 795 LPTDTQTQGPQQTQNSMISDPRVASERTLLERSNKIQYGNLLTLPIANGGILYVEPMYTERSSTGPNTSTFPQLSRVLVS 874 
15607206  790 LPTDTLTQGPQQIQNSMISDTRVASERTLLERSNRIHYGNLLSLPIADGGVLYVEPLYTERISTSPSSSTFPQLSRVLVS 869 
111025452 794 LPTDTQTQGPRQTQNSMISDTRVASERTLLERSNRIYYANLLTLPIADGGILYVEPVFTERLTSTPNSSTFPQLARVLVS 873 
15839443  790 LPTDTLTQGPQQIQNSMISDTRVASERTLLERSNRIHYGNLLSLPIADGGVLYVEPLYTERISTSPSSSTFPQLSRVLVS 869 
31791241  790 LPTDTLTQGPQQIQNSMISDTRVASERTLLERSNRIHYGNLLSLPIADGGVLYVEPLYTERISTSPSSSTFPQLSRVLVS 869 
121635974 790 LPTDTLTQGPQQIQNSMISDTRVASERTLLERSNRIHYGNLLSLPIADGGVLYVEPLYTERISTSPSSSTFPQLSRVLVS 869 
148659824 790 LPTDTLTQGPQQIQNSMISDTRVASERTLLERSNRIHYGNLLSLPIADGGVLYVEPLYTERISTSPSSSTFPQLSRVLVS 869 
54026499  795 LPTDTQTQGPQQTQNTMTTAPQVSQEKTLLSNSNKIRYGNLLTLPIADGGILYVEPFYNER-NTGPNTATFPQLLRVLVS 873 
111023352 795 LPTDTQTQGPQQTQNSMISDPRVASERTLLERSNKIQYGNLLTLPIADGGILYVEPMYTERSSTGPNTSTFPQLSRVLVS 874 
224988447 790 LPTDTLTQGPQQIQNSMISDTRVASERTLLERSNRIHYGNLLSLPIADGGVLYVEPLYTERISTSPSSSTFPQLSRVLVS 869 
226305718 788 LPTDTQTQGPQQAQSAMTSDSRVASEVSLLKQSNKIQYGNLLTLPIAEGGILYVEPLYSQR----NSQNAFPQLARVLVS 863 
253796980 790 LPTDTLTQGPQQIQNSMISDTRVASERTLLERSNRIHYGNLLSLPIADGGVLYVEPLYTERISTSPSSSTFPQLSRVLVS 869 
226365859 875 YREPPPSNSVRVGYAPTLAQALDQVFGAGTGSVATAPSAEEGTPPETGTTPPVEQGAAPPA--PTAP---ATPPSGTDV- 948 
15607206  870 VREPRTEGGVRVGYAPTLAESLDQVFGPGTGRVATARGGDAASAPPPGAGGPAPPQAVPPPrtTQPP---AAPPRGPDVp 946 
111025452 874 YREPG-TGGVRIGYAPTLAEALDQVFGTGTGAVATAPGGDATTPPPTGGQPPAPPPPGAPP---------APPPATSDQl 943 
15839443  870 VREPRTEGGVRVGYAPTLAESLDQVFGPGTGRVATXPGGDAASAPPPGAGGPAPPQGVPPPrtTQPP---AAPPRGPDVp 946 
31791241  870 VREPRTEGGVRVGYAPTLAESLDQVFGPGTGRVATAPGGDAASAPPPGAGGPAPPQAVPPPrtTQPP---AAPPRGPDVp 946 
121635974 870 VREPRTEGGVRVGYAPTLAESLDQVFGPGTGRVATAPGGDAASAPPPGAGGPAPPQAVPPPrtTQPP---AAPPRGPDVp 946 
148659824 870 VREPRTEGGVRVGYAPTLAESLDQVFGPGTGRVATARGGDAASAPPPGAGGPAPPQAVPPPrtTQPP---AAPPRGPDVp 946 
54026499  874 YRDQ--AGSVKVGYASTLAEALNQVL-PGAGSLATPFGGDPATRPQPGTAPPVVDSTQPPAdgGTPQpqtTPPPTGSAAk 950 
111023352 875 YREPPPSNSVRVGYAPTLAQALDQVFGAGTGSVATAPSAEEGTPPETGTTPPVDQGAAPAP---TAP---ATPPSGTDV- 947 
224988447 870 VREPRTEGGVRVGYAPTLAESLDQVFGPGTGRVATAPGGDAASAPPPGAGGPAPPQAVPPPrtTQPP---AAPPRGPDVp 946 
226305718 864 FSD---TNGIRIGYAPTVSEAISQIW-PGAGSAATVT--QPAPDPDTGAQPETPTTPTAPA-----------PPASSDDv 926 
253796980 870 VREPRTEGGVRVGYAPTLAESLDQVFGPGTGRVATAPGGDAASAPPPGAGGPAPPQAVPPPrtTQPP---AAPPRGPDVp 946 
226365859 949 SAAVAELDASLDALTaaqrsgdfaaygAALARVQKAVAAYEAIPK 993 
15607206  947 PATVAELRETLADLR------------AVLDRLEKAIDAAETPGG 979 
111025452 944 TAAVLELNNALANLReaqhtgdfttygAALDRLQQAIDTYLAAGG 988 
15839443  947 PATVAELRETLADLR------------AVLDRLEKAIDAAETPGG 979 
31791241  947 PATVAELRETLADLR------------AVLDRLEKAIDAAETPGG 979 
121635974 947 PATVAELRETLADLR------------AVLDRLEKAIDAAETPGG 979 
148659824 947 PATVAELRETLADLR------------AVLDRLEKAIDAAETPGG 979 
54026499  951 DAAAAELDRKIEAVRnamrsgnfqdfgKALEELEAAVKTYQDAGR 995 
111023352 948 SAAVAELDASLDALTsaqrsgdfaaygAALARVQKAVAAYEAIPK 992 
224988447 947 PATVAELRETLADLR------------AVLDRLEKAIDAAETPGG 979 
226305718 927 TKALAEVNSAMAALKsaqqsgdftsygAALDRLQKAVDAYQALPR 971 
253796980 947 PATVAELRETLADLR------------AVLDRLEKAIDAAETPGG 979 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap