Conserved Protein Domain Family
PRK12436

?
PRK12436: PRK12436 
UDP-N-acetylmuramate dehydrogenase
Statistics
?
PSSM-Id: 171497
View PSSM: PRK12436
Aligned: 20 rows
Threshold Bit Score: 606.621
Threshold Setting Gi: 152977322
Created: 9-Dec-2010
Updated: 17-Jun-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49481099    1 MNMQEVYEYLSTVLPEGHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANKYNIPVTFLGNGSNVIIKDGGIR 80 
52140460    1 MNMQEVYEYLSTVLPEGHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANKYNIPVTFLGNGSNVIIKDGGIR 80 
30023100    1 MNMQEVYKYLSTVLPEGHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANEYNIPVTFLGNGSNVIIKDGGIR 80 
163942791   1 MNMHEVYKYLSTVLPEGHVKQDEMLKNHTHIKVGGKADVFVSPTNYDEIQEVIKYANQYNIPVTFLGNGSNVIIKDGGLR 80 
218235193   1 MNMQEVYKYLSTVLPEGHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANEYNIPVTFLGNGSNVIIKDGGIR 80 
217962551   1 MNMQEVYEYLSTVLPEGHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQKVIKYANKYNIPVTFLGNGSNVIIKDGGIR 80 
218900220   1 MNMQEVYKYLSTVLPEGHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANEYNIPVTFLGNGSNVIIKDGGIR 80 
222098520   1 MNMQEVYEYLSTVLPEGHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQKVIKYANKYNIPVTFLGNGSNVIIKDGGIR 80 
225867054   1 MNMQEVYEYLSTVLPEGHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQKVIKYANKYNIPVTFLGNGSNVIIKDGGIR 80 
296505506   1 MNMQEVYKYLSTVLPEGHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANEYNIPVTFLGNGSNVIIKDGGIR 80 
49481099   81 GITVSLIHITGVTVTGTTIVAQCGAAIIDVSRIALDHNLTGLEFACGIPGSVGGALYMNAGAYGGEISFVLTEAVVMTGD 160
52140460   81 GITVSLIHITGVTVTGTTIVAQCGAAIIDVSRIALDHNLTGLEFACGIPGSVGGALYMNAGAYGGEISFVLTEAVVMTGD 160
30023100   81 GITVSLIHITGVTVTGTTIVAQCGAAIIDVSRIALDHNLTGLEFACGIPGSVGGALYMNAGAYGGEISFVLTEAVVMTGD 160
163942791  81 GITVSLIHITNVTVTGTAIVAGCGAAIIDVSRIALDHCLTGLEFACGIPGSVGGALYMNAGAYGGEVAYVLTEAVVMTGD 160
218235193  81 GITVSLIHITGVTVTGTTIVAQCGAAIIDVSRIALDHNLTGLEFACGIPGSVGGALYMNAGAYGGEISFVLTEAVVMTGD 160
217962551  81 GITVSLIHITGVTVTGTTIVAQCGAAIIDVSRIALDHNLTGLEFACGIPGSVGGALYMNAGAYGGEISYVLTEAVVMTGD 160
218900220  81 GITVSLIHITGVTVTGTTIVAQCGAAIIDVSRIALDHNLTGLEFACGIPGSVGGALYMNAGAYGGEISFVLTEAVVMTGD 160
222098520  81 GITVSLIHITGVTVTGTTIVAQCGAAIIDVSRIALDHNLTGLEFACGIPGSVGGALYMNAGAYGGEISYVLTEAVVMTGD 160
225867054  81 GITVSLIHITGVTVTGTTIVAQCGAAIIDVSRIALDHNLTGLEFACGIPGSVGGALYMNAGAYGGEISYVLTEAVVMTGD 160
296505506  81 GITVSLIHITGVTVTGTTIVAQCGAAIIDVSRIALDHNLTGLEFACGIPGSVGGALYMNAGAYGGEISFVLTEAVVMTGD 160
49481099  161 GELRTLTKEAFEFGYRKSVFANNHYIILEARFELEEGLYEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNFAGKLI 240
52140460  161 GELRTLTKEAFEFGYRKSVFANNHYIILEARFELEEGVHEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNFAGKLI 240
30023100  161 GELRTLTKEAFEFGYRKSVFANNHYIILEARFELEEGVHEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNFAGKLI 240
163942791 161 GELRTLTKDAFEFGYRKSVFANNHYIILEARFELEEGVREEIKEKMDDLTYKRESKQPLEYPSCGSVFKRPPNNFAGKLI 240
218235193 161 GELRTLTKEAFEFGYRKSVFANNHYIILEARFELEEGVHEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNFAGKLI 240
217962551 161 GELRTLTKEAFEFGYRKSVFANNHYIILEARFELEEGVYEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNFAGKLI 240
218900220 161 GELRTLTKEAFEFGYRKSVFANNHYIILEARFELEEGVREEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNFAGKLI 240
222098520 161 GELRTLTKEAFEFGYRKSVFANNHYIILEARFELEEGVYEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNFAGKLI 240
225867054 161 GELRTLTKEAFEFGYRKSVFANNHYIILEARFELEEGVYEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNFAGKLI 240
296505506 161 GELRTLTKEAFEFGYRKSVFANNHYIILEARFELEEGVHEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNFAGKLI 240
49481099  241 QESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLEREVRIIGEDKE 305
52140460  241 QDSGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLEREVRIIGEDKE 305
30023100  241 QDSGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLEREVRIIGEDKE 305
163942791 241 QESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQTTVEEKFGVKLEREVRIIGEDLQ 305
218235193 241 QDSGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLEREVRIIGEDKE 305
217962551 241 QESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLEREVRIIGEDKE 305
218900220 241 QDSGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLEREVRIIGEDKE 305
222098520 241 QESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLEREVRIIGEDKE 305
225867054 241 QESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLEREVRIIGEDKE 305
296505506 241 QDSGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLEREVRIIGEDKE 305
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap