Conserved Protein Domain Family
PRK12434

?
PRK12434: PRK12434 
tRNA pseudouridine(38-40) synthase TruA
Statistics
?
PSSM-Id: 171495
View PSSM: PRK12434
Aligned: 36 rows
Threshold Bit Score: 411.075
Threshold Setting Gi: 118443953
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18309973    1 MRNIKITLDYDGSKYKGWQKQnqkGSNVSTVQDKLEKVLTKMTSEEIQLIGCGRTDSGVHAKNYVANFKTNSLMTLEQII 80 
118443953   1 MRNIKLTIQYDGTRYKGWQKL---GNNDNTIQHKIESVLGELLKEEVALIASGRTDAGVHANMQVANFKTDSRISNDEIS 77 
148379875   1 MTNIKLYIQYDGSKYNGWQKQ---KENDNTIQGKIENVLSLMTGEDINLIASGRTDTGVHANMQVANFHTTFQGSTDEIL 77 
153930931   1 MTNIKLYIQYDGSKYNGWQKQ---KENDNTIQGKIENVLSLMTGEDINLIASGRTDTGVHANMQVANFHTTFQGSTDEIL 77 
153935153   1 MTNIKLYIQYDGSKYNGWQKQ---KENDNTIQGKIENVLSLMTGEDINLIASGRTDTGVHANMQVANFHTTFQGSTDEIL 77 
153939803   1 MTNIKLYIQYDGSKYNGWQKQ---KENDNTIQGKIENVLSLMTGEDINLIASGRTDTGVHANMQVANFHTTFQGSTDEIL 77 
170754451   1 MTNIKLYIQYDGSKYNGWQKQ---KENDNTIQGKIENVLSLMTGEDINLIASGRTDTGVHANMQVANFHTTFQCSTDEIL 77 
170760365   1 MTNIKLYIQYDGSKYNGWQKQ---KENDNTIQGKIENVLSLMTGEDINLIASGRTDTGVHANMQVANFHTTFQGSTDEIL 77 
226949212   1 MTNIKLYIQYDGSKYNGWQKQ---KENDNTIQGKIENVLSLMTREDINLIASGRTDTGVHANMQVANFHTTFQGSTDEIL 77 
260683444   1 MRNIKMIVAYDGSRYKGYQKL---GDNNMTIQEKLENVLSKMTNETVEIIGSGRTDMGAHARGQVVNFRTNCMDSLDKIQ 77 
18309973   81 EYINEYLPEDIRVTEIREASERFHARFNVKSKTYEYTIDNNKFKDVFLRKYAWHVEEKLDLEAMEEGAKYLLGTHDFKSF 160
118443953  78 KYLYKYLPQDIVVKSVNEASENFHSRYNVKEKVYTYRIHNSEVHDVFTRKYSYHVREKLDLKKMKEASKLFIGEHDFKSF 157
148379875  78 SYCYEYLPKDIVVYDAFHVDERFHSRLNVKKKKYTYKICNKKFHDVFSRKYSYHVPETLDIEAMKEACTYLVGRHDFASF 157
153930931  78 SYCYEYLPKDIVVYDAFHVDERFHSRLNVKKKKYTYKICNKKFHDVFSRKYSYHVPETLDIEAMKEACTYLVGRHDFASF 157
153935153  78 SYCYEYLPKDIVVYDAFHVDERFHSRLNVKKKKYTYKICNKKFHDVFSRKYSYHVPETLDIEAMKEACTYLVGRHDFASF 157
153939803  78 SYCYEYLPKDIVVYDAFHVDERFHSRLNVKKKKYTYKICNKKFHDVFSRKYSYHVPETLDIEAMKEACTYLVGRHDFASF 157
170754451  78 NYCYEYLPKDIVVYDAFHVDERFHSRLNVKKKKYTYKICNKKFHDVFSRKYSYHVPETLDIEAMKEACTYLVGRHDFASF 157
170760365  78 NYCYEYLPKDIVVYDAFHVDERFHSRLNVKKKKYTYKICNKKFHDVFSRKYSYHIPETLDINAMKEACTYLVGRHDFASF 157
226949212  78 NYCYEYLPKDIVVYDAFHVDERFHSRLNVKKKKYTYKICNKKFHDVFSRKYSYHIPETLDINAMKEACTYLVGRHDFASF 157
260683444  78 KYLYEYLPEDIVVKTVEEVDERFHSRYNVKSKTYMYKIDNNKYHNPFIRKYATHVSKKLDLDRMRKASEYLVGEHDFTSF 157
18309973  161 TSLKSKNKSTLRTINSIEFHENNNILSIKINGNGFLLNMVRIMVGTLVDVGLGKIEPKYINDILEAKERAKASEKAPAHG 240
118443953 158 TALKSKKKSTVKTINSITFRKKEDDIEIVFSGNGFLYKMIRILVGTLVEVGLNKISIDDVKDVMDKKDRSIAPETAPAHG 237
148379875 158 TAARSKKKSTVRTLYSIDIIKKDSYVDIVYLGSGFLHKMIRILTGTLIEIGLHNLKSVDVKIILDAEDRRKAGPTAPSQG 237
153930931 158 TAARSKKKSTVRTLYSIDIIKKDSYVDIVYLGSGFLHKMIRILTGTLIEIGLHNLKSVDVKIILDAEDRRKAGPTAPSQG 237
153935153 158 TAARSKKKSTVRTLYSIDIIKKDSYVDIVYLGSGFLHKMIRILTGTLIEIGLHNLKSVDVKIILDAEDRRKAGPTAPSQG 237
153939803 158 TAARSKKKSTVRTLYSIDIIKKDGYVNLVYLGSGFLHKMIRILTGTLIEVGLHNLKSVDVKNILKAEDRRKAGPTAPSQG 237
170754451 158 TAARSKKKSTVRTLYSIDIIKKDSYVDIVYLGSGFLHKMIRILTGTLIEIGLHNLKSVDVKIILEAEDRRKAGPTAPSQG 237
170760365 158 TAARSKKKSTVRTLYSIDIIKKDGYVDLVYLGSGFLHKMIRILTGTLIEVGLHNLKSVDVKNILEVEDRRKAGPTAPSQG 237
226949212 158 TAARSKKKSTVRTLYSIDIIKKDGYVDLVYLGSGFLHKMIRILTGTLIEVGLHNLKSVDVKNILTAEDRRKAGPTAPSQG 237
260683444 158 ASSKSKKKSNVREIYSINIKEDDNVIEIYVEGNGFLYNMVRIIVGALIDVGLKRRAPQDIKYMLESKDRCQSSDTAPAKG 237
18309973  241 LCLLELNY 248
118443953 238 LTLTEVKY 245
148379875 238 LFMTSVDY 245
153930931 238 LFMTSVDY 245
153935153 238 LFMTSVDY 245
153939803 238 LFMTSVDY 245
170754451 238 LFMTSVDY 245
170760365 238 LFMTSVDY 245
226949212 238 LFMTSVDY 245
260683444 238 LCLWKVTY 245
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap