Conserved Protein Domain Family
PRK12423

?
PRK12423: PRK12423 
LexA repressor; Provisional
Statistics
?
PSSM-Id: 171489
View PSSM: PRK12423
Aligned: 19 rows
Threshold Bit Score: 334.05
Threshold Setting Gi: 78046779
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
104781524   1 MDNLTPKRRAILDFIRERiTDQAQPPSLADIAERFGFASRSVARKHITALCQAGYIDVTPNQARGIRLAEPLRRPEILEL 80 
28869978    1 MSTLSPRRSAILTFIRDRiAQQGQSPSLAEISEAFGFASRSVARKHIVALTEAGLIEVVAHQARGIRLLNSEPRPELLEI 80 
77459374    4 MTTLTPRRTAILTFIRERiAEHGQPPSLAEISEAFGFASRSVARKHVLALTEAGFIEVNPHQARGIRLLGQPARPELLEV 83 
71736633    4 MSTLSPRRSAILTFIRDRiAQQGQSPSLAEISEAFGFASRSVARKHIMALTEAGLIEVVAHQARGIRLLNSEPRPELLEI 83 
66045756    4 MSTLSPRRSAILTFIRDRiAQQGQSPSLAEISEAFGFASRSVARKHIVALTEAGLIEVVPHQARGIRLLNTEPRPELLEI 83 
26989835    1 MDTLTPKRRAIFEFIRERiAEHGQPPSLADIATRFGFASRSVARKHITALCQAGYIDVTPNQARGIRLAEPLRRPEILEI 80 
148547818   4 MDTLTPKRRAIFEFIRERiAEHGQPPSLADIATRFGFASRSVARKHITALCQAGYIDVTPNQARGIRLAEPLRRPEILEI 83 
167033743   4 MDNLTPKRRAIFEFIRERiAEHSQPPSLADIATRFGFASRSVARKHITALCQAGYIDVTPNQARGIRLAEPLRRPEILEI 83 
170721606   4 MDNLTPKRRAILDFIRERiTDHGQPPSLADIAIRFGFASRSVARKHITALCQAGYIDVTPNQARGIRLAAPLRRPEILEV 83 
188577892   1 MPPLTPQRAAVLAFLQEQ-AQAGVSPSLAEIAQAFGFASRNAAQKHVQALAEAGLIELLPNQKRGIRVPGGAGRDALLNL 79 
104781524  81 PVLGQVAAGAPIGPDLDIHEQLLLDPSLFRRTPDYLLKVRGDSMVDDGIFDGDLVGIRQQGDARDGQIVVARLDGEVTIK 160
28869978   81 PVLGRVAAGAPIGPDLDIHTTLHLDRSTFTRVPDYLLRVQGDSMIEDGILDGDLVGVHRNPQASDGQIVVARLEGEVTIK 160
77459374   84 PVLGRVAAGAPIGADADLHNRLMLDPALFSRTPDYMLRVQGDSMIEDGILDGDLVGVRRNPEALNGQIVVARLDGEVTIK 163
71736633   84 PVLGRVAAGAPIGPDLDIHTTLHLDRSTFTRVPDYLLRVQGDSMIEDGILDGDLVGVHRNPQASDGQIVVARLDGEVTIK 163
66045756   84 PVLGRVAAGVPIGPDLDIHTTLHLDRSTFTRVPDYLLRVQGDSMIEDGILDGDLVGVHRNPQASDGQIVVARLDGEVTIK 163
26989835   81 PVLGQVAAGAPIGPDLGIHEQLLLDPSLFRRTPDYLLKVRGDSMIDDGIFDGDLVGILQQADARDGQIVVARLDGEVTIK 160
148547818  84 PVLGQVAAGAPIGPDLDIHEQLLLDPSLFRRTPDYLLKVRGDSMIDDGIFDGDLVGILQQADARDGQIVVARLDGEVTIK 163
167033743  84 PVLGQVAAGAPIGPDLDIHEQLLLDPSMFRRTPDYLLKVRGDSMIDDGIFDGDLVGILQQADARDGQIVVARLDGEVTIK 163
170721606  84 PVLGQVAAGAPIGPDLGIHEQLLIDPSLFRRTPDYLLKVRGDSMINDGIFDGDLVGIRQQGEARDGQIVVARLDGEVTIK 163
188577892  80 PVLGRVAAGVPIGADIGLERQLWLDRALFSLRPDYLLQVQGDSMIDDGILDGDLVGVHRSKEARDGQIVVARVDGEITIK 159
104781524 161 RLQRTREGYRLLPRNPHYQPIDVGPERDFFIEGVFCGLLRRD 202
28869978  161 RLQHRGDQLHLLPRNPAYQPIIVTPDQDFAIEGVFCGLVRRE 202
77459374  164 RFERVGDAVRLLPRNPAYQPIVVRADQDLAIEGVFCGLVRQG 205
71736633  164 RLHRSADQVRLLPRNPAYEPIIVTPDQDFAIEGVFCGLVRRE 205
66045756  164 RLQRRADQVRLLPRNPAYEPIIVTPDQDFAIEGVFCGLVRRE 205
26989835  161 RLQRQGGTYRLLPRNPAYAPIDVQPEQDFFIEGVFCGLLRRD 202
148547818 164 RLQRQGGTYRLLPRNPAYAPIDVQPEQDFFIEGVFCGLLRRD 205
167033743 164 RLQRQGGNYRLLPRNPAYAPIDVQPEQEFFIEGVFCGLLRRD 205
170721606 164 RLQRQPGGYRLLPRNPAYAPIDVGPEREFFIEGVFCGLLRRD 205
188577892 160 RLERGTERIRLLPRNRAHAPIVVAADADFAIEGLYCGLIRQG 201
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap