Conserved Protein Domain Family
PRK12403

?
PRK12403: PRK12403 
aspartate aminotransferase family protein
Statistics
?
PSSM-Id: 171472
View PSSM: PRK12403
Aligned: 12 rows
Threshold Bit Score: 882.685
Threshold Setting Gi: 78059765
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
78059765    1 MNAPNFPHRTTQDYQRSDAAHHLHAFVDQKALNEEGARVMVRGEGVHLWDNDGNRYLDGMSGLWCTNVGYGRPELVDAAA 80 
104781956   1 MNAPFSPKRDTRDYQASDAAHHIHAFLDQKALNAEGPRVITRGEGLYLWDNDGRRYLDGMSGLWCTQLGYGRKDLTAAAA 80 
77461153    1 ----MTTSRETRDYQAADAAHHIHAFVDQKALNDEGPRVMVRGDRLHLWDNDGRRYLDGMSGLWCTNLGYGRKDLNAAAS 76 
26989307    1 MNAPFAPQRQTRDYQAADAAHHIHAFLDQKALNAEGPRVIVGGERLHLWDSEGKRYLDGMSGLWCTQLGYGRRDLTAAAA 80 
70730883    6 QQPQPAAPRSTQDYQAADAAHHIHAFLDQKALNAEGPRVIVRGEGLHLWDNDGKRYLDGMSGLWCTNLGYGRKDLAAAAS 85 
15595418    1 MTAQLNPQRDTRDYQQLDAAHHIHAFLDQKALNREGPRVMVRGDGLQLWDNDGKRYLDGMSGLWCTNLGYGRQDLAAAAS 80 
116053934   1 MTAQLNPQRDTRDYQQLDAAHHIHAFLDQKALNREGPRVMVRGDGLQLWDNDGKRYLDGMSGLWCTNLGYGRQDLAAAAS 80 
148548338   1 MNAPFAPQRQTRDYQAADAAHHIHAFLDQKALNAEGPRVIVGGERLHLWDSEGKRYLDGMSGLWCTQLGYGRRDLTAAAA 80 
167034247   1 MNAPFAPQRQTRDYQAADAAHHIHAFLDQKALNAEGPRVIVGGERLHLWDSEGKRYLDGMSGLWCTQLGYGRRDLTAAAA 80 
152988121   1 MTAQLNPQRDTRDYQQLDAAHHIHAFLDQKALNREGPRVMVRGNGLQLWDNDGKRYLDGMSGLWCTNLGYGRQDLAAAAS 80 
170722044   1 MNAPFQPQRDTRDYQASDAAHHIHAFLDQKALNAEGPRVITRGERLYLWDNDGRRYLDGMSGLWCTQLGYGRKDLTAAAA 80 
218888962   1 MTAQLNPQRDTRDYQQLDAAHHIHAFLDQKALNREGPRVMVRGDGLQLWDNDGKRYLDGMSGLWCTNLGYGRQDLAAAAS 80 
78059765   81 RQMKELSYYNMFFHTTHPSVIELSERLFALLGNRFSHVVYTNSGSESNEVLIRTVRRFWDVMGKPEKKVLIGRVNGYHGS 160
104781956  81 AQMDQLAYYNMFFHTTHPAVIELSELLFSLLPGHYSHAIYTNSGSEANEVLIRTVRRYWQVVGKPQKKIMIGRWNGYHGS 160
77461153   77 RQLEQLPYYNMFFHTTHPQVIELSELLFSLLPGHYSHAIYTNSGSEANEVLIRTVRRYWQVLGKPEKKIMIGRWNGYHGS 156
26989307   81 TQMDQLAYYNMFFHTTHPAVIELSELLFSLLPGHYSHAIYTNSGSEANEVLIRTVRRYWQVVGQPGKKIMIGRWNGYHGS 160
70730883   86 AQLEQLPYYNMFFHTTHPAVVELSELLFSLLPGHYSHAIYTNSGSEANEVLIRSVRRYWQILGQPQKKVMIGRWNGYHGS 165
15595418   81 RQLEQLPYYNMFFHTTHPAVVELSEMLFSLLPDHYSHAIYTNSGSEANEVLIRTVRRYWQILGKPQKKIMIGRWNGYHGS 160
116053934  81 RQLEQLPYYNMFFHTTHPAVVELSEMLFSLLPDHYSHAIYTNSGSEANEVLIRTVRRYWQILGKPQKKIMIGRWNGYHGS 160
148548338  81 TQMDQLAYYNMFFHTTHPAVIELSELLFSLLPGHYSHAIYTNSGSEANEVLIRTVRRYWQVVGQPGKKIMIGRWNGYHGS 160
167034247  81 TQMDQLAYYNMFFHTTHPAVIELSELLFSLLPGHYSHAIYTNSGSEANEVLIRTVRRYWQVVGQPSKKVMIGRWNGYHGS 160
152988121  81 RQLEQLPYYNMFFHTTHPAVVELSELLFSLLPDHYSHAIYTNSGSEANEVLIRTVRRYWQILGKPQKKIMIGRWNGYHGS 160
170722044  81 AQMDQLAYYNMFFHTTHPAVIELSELLFSLLPGHYSHAIYTNSGSEANEVLIRTVRRYWQVVGQPNKKVMIGRWNGYHGS 160
218888962  81 RQLEQLPYYNMFFHTTHPAVVELSEMLFSLLPDHYSHAIYTNSGSEANEVLIRTVRRYWQILGKPQKKIMIGRWNGYHGS 160
78059765  161 TVGSASLGGMAFMHEMGDLpIPNITHVDEPYWYANGGDLSPEAFGKQAALSLERKILEIGADRVAAFVAEPFQGAGGMIF 240
104781956 161 TLAATALGGMKFMHEMGGL-IPDVAHIDEPYWFAEGGELTPAEFGRRCALQLEEKILELGAENVAGFIAEPFQGAGGMIF 239
77461153  157 TLAATALGGMKFMHEMGGM-IPDIAHIDEPYFFAHEGNLTPAEFGLRAAQQLEAKILELGADKVAGFIAEPFQGAGGMIF 235
26989307  161 TLAATALGGMKFMHDMGGL-IPDVAHIDEPYWYAEGGELTPAEFGRRCALQLEEKILELGAENVAGFIAEPFQGAGGMIF 239
70730883  166 TLAATALGGMKFMHDMGGL-IPDVAHIDEPYWFAHEGNLTPAEFGLRCARQLEEKILELGAENVAGFIAEPFQGAGGMIF 244
15595418  161 TLGSTALGGMKFMHEMGGM-LPDFAHIDEPYWYANGGELSPAEFGRRAALQLEEKILELGAENVAAFVAEPFQGAGGMIF 239
116053934 161 TLGSTALGGMKFMHEMGGM-LPDFAHIDEPYWYANGGELSPAEFGRRAALQLEEKILELGAENVAAFVAEPFQGAGGMIF 239
148548338 161 TLAATALGGMKFMHDMGGL-IPDVAHIDEPYWYAEGGELTPAEFGRRCALQLEEKILELGAENVAGFIAEPFQGAGGMIF 239
167034247 161 TLAATALGGMKFMHEMGGL-IPDVAHIDEPYWYAEGGELTPAEFGRRCALQLEEKILELGAENVAGFIAEPFQGAGGMIF 239
152988121 161 TLGSTALGGMKFMHEMGGM-LPDFAHVDEPYWYANGGELSPAEFGRRAALQLEEKILELGAENVAAFVAEPFQGAGGMIF 239
170722044 161 TLAATALGGMKFMHEMGGL-IPDVAHIDEPYWYAEGGELTPAEFGRRCALQLEEKILELGAENVAGFVAEPFQGAGGMIF 239
218888962 161 TLGSTALGGMKFMHEMGGM-LPDFAHIDEPYWYANGGELSPAEFGRRAALQLEEKILELGAENVAAFVAEPFQGAGGMIF 239
78059765  241 PPDGYWQEIERICRQYDVLLCADEVIGGFGRTGEWFAHRHFGFEPDLICVAKGLTSGYVPMGGLIMSRRVGDALVDKGGV 320
104781956 240 PPESYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHQHFGFEPDTLSIAKGLTSGYVPMGGLVLSKRIAEALVERGGV 319
77461153  236 PPESYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHEYFGFEPDTLSIAKGLTSGYIPMGGLILSKKMADVLVEQGGV 315
26989307  240 PPESYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHEYFGFEPDTLSIAKGLTSGYVPMGGLVLSKRIAEALVERGGV 319
70730883  245 PPESYWPQIQRICRQYDVLLCADEVIGGFGRTGEWFAHQHFGFEPDTLSIAKGLTSGYIPMGGLVLSKRIAQVLVEQGGV 324
15595418  240 PPQSYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHEHFGFQPDTLSIAKGLTSGYIPMGGLVLGKRIAEVLVEQGGV 319
116053934 240 PPQSYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHEHFGFQPDTLSIAKGLTSGYIPMGGLVLGKRIAEVLVEQGGV 319
148548338 240 PPESYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHEYFGFEPDTLSIAKGLTSGYVPMGGLVLSKRIAEALVERGGV 319
167034247 240 PPESYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHEYFGFEPDTLSIAKGLTSGYVPMGGLVLSKRIAEALVERGGV 319
152988121 240 PPESYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHEHFGFQPDTLSIAKGLTSGYIPMGGLVLGKRIAEVLVEQGGV 319
170722044 240 PPESYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHEYFGFEPDTLSIAKGLTSGYVPMGGLVLSKRIAEALVERGGV 319
218888962 240 PPQSYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHEHFGFQPDTLSIAKGLTSGYIPMGGLVLGKRIAEVLVEQGGV 319
78059765  321 YAHGLTYSGHPVAAAVALANLDVLEREGLVERTKTDTGPYLQKALRDAFGSHPLVGEVQGVGAVGAIQFAKNKATRERFA 400
104781956 320 FAHGLTYSGHPVAAAVAIANLKALRDDGIVRQVKDDTGPYLQRILREVFADHPLIGEVQGAGLVAALQFAEDKNTRKRFA 399
77461153  316 FAHGLTYSGHPVAAAVAIANLKALRDEGVVTRVKDDIGPYLQQCLREVFGNHPLVGDIQGTGMVAALQLAEDKATRKRFA 395
26989307  320 FAHGLTYSGHPVAAAVAIANLKALRDEGIVRQVKDDTGPYLQRILREVFADHPLIGQVQGAGLVAALQFAEHKPTRKRFA 399
70730883  325 FAHGLTYSGHPVAAAVAIANLKALRDEGVVSQVKNDTGPYLQQCLREVFGNHPLIGEIQGTGLVAALQFAEDKASRKRFA 404
15595418  320 FAHGLTYSGHPVAAAVAIANLKALRDEGVVTRVREETGPYLQRCLREVFGDHPLVGEVQGAGFVAALQFAEDKVTRKRFA 399
116053934 320 FAHGLTYSGHPVAAAVAIANLKALRDEGVVTRVREETGPYLQRCLREVFGDHPLVGEVQGAGFVAALQFAEDKATRKRFA 399
148548338 320 FAHGLTYSGHPVAAAVAIANLKALRDEGIVRQVKDDTGPYLQRILREVFADHPLIGQVQGAGLVAALQFAEHKPTRKRFA 399
167034247 320 FAHGLTYSGHPVAAAVAIANLKALRDEGIVRQVKDDTGPYLQRILREVFADHPLIGQVQGAGLVAALQFAEHKPTRKRFV 399
152988121 320 FAHGLTYSGHPVAAAVAIANLKALRDEGVVTRVRDETGPYLQGCLREVFGAHPLVGEVQGAGFVAALQFAEDKATRRRFA 399
170722044 320 FAHGLTYSGHPVAAAVAIANLKALRDEGIVRQVKDDTGPYLQRILREVFANHPLIGQVQGAGLVAALQFAEDKGSRKRYA 399
218888962 320 FAHGLTYSGHPVAAAVAIANLKALRDEGVVTRVREETGPYLQRCLREVFGDHPLVGEVQGAGFVAALQFAEDKATRKRFA 399
78059765  401 NEADLTWHSRTVGFELGAIVRSTNGRLIVAPPLVIDHAQIDELVDTMRKAVDATAREVlgIDC 463
104781956 400 NENDLAWQCRTFGFEEGVIIRSTLGRMIMAPALVASRSELDELVEKTRIAVNRTARLV--GRL 460
77461153  396 NENDIAWRCRTIGFEEGVIIRSTLGRMIMAPALIASREEIDELVGKTLKALDRTAQEY--GRL 456
26989307  400 NENDLAWQCRTFGFEEGVIIRSTLGRMIMAPALIANHSELDELVEKTRIAVDRTARLV--GKL 460
70730883  405 NENDIAWRCRTLGFEEGVIIRSTFGRMIMAPALVASRGDIDELVDKTRRAVERTAGEIeaGTL 467
15595418  400 NENDLAWRCRTIGFEEGVIIRSTLGRMIMAPALVAGRAEIDELIDKTRIAVDRTAREI--GVL 460
116053934 400 NENDLAWRCRTIGFEEGVIIRSTLGRMIMAPALVAGRAEIDELIDKTRIAVDRTAREI--GVL 460
148548338 400 NENDLAWQCRTFGFEEGVIIRSTLGRMIMAPALIANHSELDELVEKTRIAVDRTARLV--GKL 460
167034247 400 NENDLAWQCRTFGFEEGVIIRSTLGRMIMAPALIANHSELDELVEKTRIAVDRTARLV--GKL 460
152988121 400 NENELAWRCRTIGFEEGVIIRSTLGRMIMAPALVAGRAEIDELIDKTRIAVDRTAREI--GVL 460
170722044 400 NENDLAWQCRTYGFEEGVIIRSTLGRMIMAPALVATHGELDELVDKTRIAVDRTARGL--GIL 460
218888962 400 NENDLAWRCRTIGFEEGVIIRSTLGRMIMAPALVAGRAEIDELIDKTRIAVDRTAREI--GVL 460
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap