Conserved Protein Domain Family
PRK12400

?
PRK12400: PRK12400 
D-amino acid aminotransferase; Reviewed
Statistics
?
PSSM-Id: 171470
View PSSM: PRK12400
Aligned: 20 rows
Threshold Bit Score: 645.534
Threshold Setting Gi: 152977436
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49481219    5 LAYERFVLWNDAVIDTTKQKTYIELEERGLQFGDGVYEVIRLYKGNFHLLDPHITRLYRSMEEIELTLPFSKAELITLLY 84 
30023265    1 MAYEKFVLWNDEVIDTTKQQTYIELEERGSQFGDGVYEVIRLYKGNFHLLDPHITRLYRSMEEVELSLPFSKAELITLLY 80 
42784396    1 MAYERFVLWNDTVIDTTKQKTYIDLEERGLQFGDGVYEVIRLYKGNFHLLDPHITRLYRSMEEIELTLPFSKAELITLLY 80 
52140331    5 LAYERFVLWNDAVIDTTKQKTYIELEERGLQFGDGVYEVIRLYKGNFHLLDPHITRLYRSMEEIELTLPFSKAELITLLY 84 
163942916   1 MAYERFVLWNDAVIDTTKHRAYIELEERGLQFGDGVYEVIRLYNGNFHLLDPHLTRLYRSLEEIELSLPFSKAELIILLY 80 
217962718   1 MAYERFVLWNDAVIDTTKQKTYIDLEERGLQFGDGVYEVIRLYKGNFHLLDPHITRLYRSMEEIELTLPFSKAELITLLY 80 
218234568   1 MAYEKFVLWNDEVIDTTKQQTYIELEERGSQFGDGVYEVIRLYKGNFHLLDPHITRLYRSMEEVELSLPFSKAELITLLY 80 
218900352  17 LAYEKFVLWNDEVIDTTKQQTYIELEERGLQFGDGVYEVIRLYKGNFHLLDPHITRLYRSMEEVELSLPFSKAELITLLY 96 
222098693   1 MAYERFVLWNDAVIDTTKQKTYIDLEERGLQFGDGVYEVIRLYKGNFHLLDPHITRLYRSMEEIELTLPFSKAELITLLY 80 
301056697   5 LAYERFVLWNDAVIDTTKQKTYIELEERGLQFGDGVYEVIRLYKGNFHLLDPHITRLYRSMEEIELTLPFSKAELITLLY 84 
49481219   85 KLIENNNFHEDGTIYLQVSRGVQARTHTFSYDVPPTIYAYITKKERPALWIEYGVRAISEPDTRWLRCDIKSLNLLPNIL 164
30023265   81 KLIERNHFHEDGTIYLQVSRGVQARTHVFSYDTPPTIYAYITKKERPALWIEYGIRAISEPDTRWLRCDIKSLNLLPNVL 160
42784396   81 KLIENNNFHEDGTIYLQVSRGVQARTHTFSYDVPPTIYAYITKKERPALWIEYGVRAISEPDTRWLRCDIKSLNLLPNIL 160
52140331   85 KLIENNNFHEDGTIYLQVSRGVQARTHTFSYDVPPTIYAYITKKERPALWIEYGVRAISEPDTRWLRCDIKSLNLLPNIL 164
163942916  81 KLIENNNFHEDGTIYLQVSRGVQARAHAFSYDISPTIYAYISKKERPSLWIEYGVRAISEPDTRWLRCDIKSLNLLPNVL 160
217962718  81 KLIENNNFHEDGTIYLQVSRGVQARTHTFSYDVPPTIYAYITKKERPALWIEYGVRAISEPDTRWLRCDIKSLNLLPNIL 160
218234568  81 KLIERNHFHEDGTIYLQVSRGVQARTHVFSYDTPPTIYAYITKKERPALWIEYGIRAISEPDTRWLRCDIKSLNLLPNVL 160
218900352  97 KLIERNHFHEDGTIYLQVSRGVQARTHVFSYDTPPTIYAYITKKERPALWIEYGIRAISEPDTRWLRCDIKSLNLLPNVL 176
222098693  81 KLIENNNFHEDGTIYLQVSRGVQARTHTFSYDVPPTIYAYITKKERPALWIEYGVRAISEPDTRWLRCDIKSLNLLPNIL 160
301056697  85 KLIENNNFHEDGTIYLQVSRGVQARTHTFSYDVPPTIYAYITKKERPALWIEYGVRAISEPDTRWLRCDIKSLNLLPNIL 164
49481219  165 AATKAERKGCKEALFVRNGTVTEGSHSNFFLIKNGTLYTHPANHLILNGIIRQYVLSLAKTLRIPVQEELFSIRDVYQAD 244
30023265  161 AATKAERKGCKEALLVRNGIVTEGSHSNFFLIKNGTLYTHPANHLILNGIIRQYVLSLANTLHIPVQEELFSVRDVYQAD 240
42784396  161 ATTKAERKGCKEALFVRNGTVTEGSHSNFFLIKNGTLYTHPANHLILNGIIRQYVLSLAKTLRIPVQEELFSVRDVYQAD 240
52140331  165 AATKAERKGCKEALFVRNGTVTEGSHSNFFLIKNGTLYTHPANHLILNGIIRQYVLSLAKTLRIPVQEELFSIRDVYQAD 244
163942916 161 AYTKAERKGCKEALLVRNGIVTEGSHSNFFLIKNGTLYTHPANHLILNGIIRQYVLSLANTLQLPVKEELFSVRDVYQAD 240
217962718 161 ATTKAERKGCKEALFVRNGTVTEGSHSNFFLIKNGTLYTHPANHLILNGIIRQYVLSLAKTLRIPIQEELFSVRDVYQAD 240
218234568 161 AATKAERKGCKEALLVRNGIVTEGSHSNFFLIKNGTLYTHPANHLILNGIIRQYVLSLANTLHIPVQEELFSVRDVYQAN 240
218900352 177 AATKAERKGCKEALLIRNGIVTEGSHSNFFLIKNRTLYTHPANHLILNGIIRQYVLSLANTLHIPVQEELFSVRDVYQAD 256
222098693 161 ATTKAERKGCKEALFVRNGTVTEGSHSNFFLIKNGTLYTHPANHLILNGIIRQYVLSLAKTLRIPIQEELFSVRDVYQAD 240
301056697 165 AATKAERKGCKEALFIRNGTVTEGSHSNFFLIKNGTLYTHPANHLILNGIIRQYVLSLAKTLRIPVQEELFSIRDVYQAD 244
49481219  245 ECFFTGTTIEILPMTHLDGTAIQDGQVGPITKMLQRSFSQSLLQSNMSSS 294
30023265  241 ECFFTGTTIEILPMTHLDGTAIQDGQVGAITKKLQKSFNKILLQSNMSSS 290
42784396  241 ECFFTGTTIEILPMTHLDGTAIQDGQVGPITKMLQRSFSQSLLQSNMSSS 290
52140331  245 ECFFTGTTIEILPMTHLDGTAIQDGQVGPITKMLQRSFSQSLLQSNMSSS 294
163942916 241 ECFFTGTTIEILPMTHLDGTAIQDGQVGPITKLLQRSFSQSLLKSNSTSS 290
217962718 241 ECFFTGTTIEILPMTHLDGTVIRDGQVGPITKMLQRSFSQSLLQSNMSSS 290
218234568 241 ECFFTGTTIEILPMTHLDGTAIQDGQVGPITKKLQKSFNQILLQSNMASS 290
218900352 257 ECFFTGTTIEILPMTHLDGTAIQDGQVGPITKKLQKSFNQILLQSNMASS 306
222098693 241 ECFFTGTTIEILPMTHLDGTVIRDGQVGPITKMLQRSFSQSLLQSNMSSS 290
301056697 245 ECFFTGTTIEILPMTHLDGTAIQDGQVGPITKMLQRSFSQSLLQSNMSSS 294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap