Conserved Protein Domain Family
PRK12392

?
PRK12392: PRK12392 
bacteriochlorophyll c synthase; Provisional
Statistics
?
PSSM-Id: 171463
View PSSM: PRK12392
Aligned: 14 rows
Threshold Bit Score: 542.36
Threshold Setting Gi: 193214301
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
193211918   1 MSVESRGFVDKVKAHLELLDPVTWISVFPCLAGGVMASGSMQPTVHDYLLLAALFLLYGPLGTGFSQSVNDYYDLELDRV 80 
78186803    7 SPRQPLGLMDKIKTHIELLDPVTWISVSPCLACGVIGTGAMQPTWHDYLLLLLLFIIYGPLGTGFSQSVNDYFDLELDRM 86 
21674803   28 MSVASQGLVDKVKAHLELLDPVTWISVFPCLAGGVMASGAMQPTVHDYLLLAALFLLYGPLGTGFSQSVNDYYDLELDRV 107
78186126    2 PSTPGTGFINKIKAHLELLDPVTWISVFPGLACGAMASGAMQATPHDYLVLFAVFLMYGPLGTGFSQSVNDYFDLELDRV 81 
78189498    3 TTTVRIGFVEKIRAHIQLLDPVTWISVFPCLTCGVMASGAMQPTVHDYLLLAALFIIYGPLGTGFSQSVNDYYDLELDRI 82 
145219119   2 AASPASGFVNKLRAHLELLDPVTWISVFPGLACGAMASGSMQATPHDFLILLAVFLMYGPLGTGFSQSVNDYFDLELDMV 81 
194334796   3 TATHRLGFTDKLRAHLELLDPVTWISVFPCLAGGVMASGAMQGTFHDYLLLLALFLMFGPLGTGFSQTINDYFDLELDRV 82 
194335520   2 AVSAKPGFTDKVRAHLELLDPVTWISVFPCLAGGVMASGAMKGTLHDYLLLFAIFLMFGPLGTGFSQSVNDCFDLELDRI 81 
189501142   4 SVNRSMSFTDKVRAHLEILDPVTWISVFPCLAGGVMASGAMQPTLHDYFLLLAIFLMFGPLGTGFSQSINDYYDLELDKV 83 
189501143   4 TANRRLSFVDKVRAHIEILDPVTWISVFPYLAGGVMVSGAMLPTLHDYLLLFAVFLMFGPLGTGFSQSINDYYDLELDSV 83 
193211918  81 NEPTRPIPSGRLSEKEAIWNWSIVLVIAVALSSWIGTSIGGERGMIFVGSLLAGLVIGYLYSAPPFKLKKNIFFSGPAVG 160
78186803   87 NEPTRPIPSGRITKREAAWNWGIVLLLALLICAGISLHIGGQRGVVFAICMLTGLFLGFVYSAPPFKLKKNIFLSAPAVG 166
21674803  108 NEPTRPIPSGRLSEKEAIWNWSIVLVIAVALSSWIGTSIGGQRGMIFVGSLLAGLVIGYLYSAPPFKLKKNIFFSAPAVG 187
78186126   82 NEPTRPIPSGRLTKQEALLNCIIVVLLAMGLGIWLGIDTGGMRGMVITTMIFSALFVAYIYSAPPFKLKKNIFASAPGVG 161
78189498   83 NEPTRPIPSGRISKKEALWNWSIILTIAIVLGGWLGIHIGGERGMLFFGCLLVGLLFGYIYSAPPLKLKKNILLSAPAVG 162
145219119  82 NEPTRPIPSGRLTKKEALLNCIVVLLLAIGIGIYVGLDTGGVRGMVIMGMIFSALFVAYIYSAPPLKLKKNIFASAPSVG 161
194334796  83 NEPTRPIPSGRLSEKEALINSIVVFVLALGIGIVLGIHVGGTRGIFITSAIAVGLFVAYIYSAPPLKLKKNILTSAPAVG 162
194335520  82 NEPTRPIPSGRLSEKEGLWNSIIALLLAMGLGIFMGVHIGGYRGWVIVSSIFAALLVAYLYSAPPFKLKKNILTSAPAVG 161
189501142  84 NEPTRPIPSGRMTEKEAVWNSVVVCLLALCLGVFLGFYIGGERGLIITSSIVAGLIVAYIYSAPPLKLKKNILTSAPAVG 163
189501143  84 NEPTRPIPSGRLTKKEALWNSMVVFFLAFGLGVFLCFYIGGARGLIIFSSITAGLIVGYIYSAPPLKLKKNILTSAPVVG 163
193211918 161 FSYGFITYLSANALFSDIRPEVLWLAGLNFFMAIALIVMNDFKSQEGDAKGGMKSLTVMIGAKNTFLVAFIIIDLVFAVF 240
78186803  167 MSYGFITYLSANALFSDIRPEIVWLAVLNFFMAMSLIIMNDFKSQKGDAESGMKSLTVLIGSRYTFLVAFLIIDLTFAGF 246
21674803  188 FSYGFITYLSANALFSDIRPEVLWLAGLNFFMAVALIVMNDFKSQEGDAKEGMKSLTVMIGAKNTFLVAFIIIDLVFAVF 267
78186126  162 FSYGFVTFLSGNALFSDIRPEVVWLAALNFFMAIALIIMNDFKSVEGDREGGMKSLTVMIGAKNTFIVAFAIIDMVFAVL 241
78189498  163 ISYGVITWISANLFFSEIRPEVLWFAGLNFFMAIALIMMNDFKSQEGDAKSGMKSLTVMIGAKNTFLVAFTIVDLVFAVF 242
145219119 162 FSYGFVTFLSGNALFSDIRPEIVWLAALNFFMAVALIILNDFKSVEGDREGGLKSLPVMIGSRNTFLVAFAIIDAVFAVL 241
194334796 163 LSYSLITFLSANALFSDIRPEAVWLAVLNFFMAIALIIMNDFKSAKGDEESGLKSLTVMIGAKNTFLVAFAIIDMVFAVF 242
194335520 162 FSYGFVSFISANALFGDIRPEAIWLASLNFFMAVALIILNDFKSAEGDKDGGLKSLTVMIGAKKTFLVSFIIIDLVFSVL 241
189501142 164 FSYSLVTWFSANALFSEIRPEVYWLAGLNFFMAMALIIMNDFKSAKGDKEGGMKSLTVMIGMKNTFLVSFIMIDLVFLVF 243
189501143 164 FYYGFITWFSANALFSEIRPEVYWLAGLNFFMAMALIILNDFKSTKGDKEGGLKSLTVMIGSKGTFLVSFIIIDLVFLVF 243
193211918 241 AWLAWDWArsnpqitqFPILVYCVVVGLVLNIIVQIPIYRDPKSGITLVQHAVDDGFGNAIGKSEVQEHNAFLRFQVVNN 320
78186803  247 AFLAWQWG--------FPVLMVMILVSLGINISVQIPIYRDPSTGASFMQGAVDDGFGNAIGKSEVNEHNAFLRFQLVNN 318
21674803  268 AWRSYMWG--------FTTLMYFIIAGLVLNIIIQIPIYRDPKSGITLVQHAVDDGFGNAIGKSEVQEHNAFLRFQVVNN 339
78186126  242 VWLAWSWG--------FMVPMALVVLGLVLNIVIQIQLLADPKGGVSFLKGTVEDGFGNAIGKSDVQEHNTFLRFQVANN 313
78189498  243 ALLAWSWN--------FQLLAYFILATLLVDLVIQFKLFTDPRQGLSFLNGAIDNSFGNAIGKSESKEHNAFLRFSMLNN 314
145219119 242 AWLSFTWG--------FTVPMVLVILGLAMNVYIQAQLLLDPKGGISFMQGAVDDGFGNAIGKSDVQEHNSFLRFQVANN 313
194334796 243 AWLTFSWG--------FTILMYVILVSLVANITIQIMLYRDPKGGLSFMQHAVDDGFGNAIGKSDVQEHNSFLRYQVANN 314
194335520 242 AYLSYSWG--------FMIPAFFVLIGLVLNLVLQVQLLRDPKGGISFLQGAVDDGFGNAIGKSDIQEHNTFLRFQVANN 313
189501142 244 AWLEYQWG--------FYYLVVLMLGGLILNIYMQVKLYADPKGGVAFMGSAVDDVFGNTIGQSEVEEHKAYLRFQIANN 315
189501143 244 AWLEYTWE--------LYPLVFLMLGGLVLNIILQIKLYRNPEGGISIANTVVKEGFGNTIGKSDVVEHNAFLRFQVANN 315
193211918 321 ILFLTNQMFAAALVGMKYM 339
78186803  319 ILFLLNQFVAAALIGMKYM 337
21674803  340 ILFLTNQMFAAALIGAKYM 358
78186126  314 VLFLVNNLVLAAMIGIRYM 332
78189498  315 FLFLINQLIAAALIGLKYI 333
145219119 314 VLFLVNNLIIAGMIGIKYM 332
194334796 315 LLFLINLLVAAGMVGARYM 333
194335520 314 ILFLLNNLLVAGMVGLKYI 332
189501142 316 VLFLSNNLFAAGAIGMKYM 334
189501143 316 IIFLFNNLIAAGAIGMKYM 334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap