Conserved Protein Domain Family
PRK12388

?
PRK12388: PRK12388 
class II fructose-bisphosphatase
Statistics
?
PSSM-Id: 171459
View PSSM: PRK12388
Aligned: 31 rows
Threshold Bit Score: 657.858
Threshold Setting Gi: 15803469
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
110806836   1 MMSLAWPLFRVTEQAALAAWPQTGCGDKNKIDGLAVTAMRQALNDVAFRGRVVIGEGEIDHAPMLWIGEEVGKGDGPEVD 80 
161506369   1 MMSLAWPLFRITEQAALAAWPQTGCGDKNRIDGLAVTAMRQALNDIAIRGRIVIGEGEIDHAPMLWIGEEVGNGEGPEVD 80 
170680034   1 MMSLAWPLFRVTEQAALAAWPQTGCGDKNKIDGLAVTAMRQALNDVAFRGRVVIGEGEIDHAPMLWIGEEVGKGDGPEVD 80 
194734320   1 MMSLAWPLFRITEQAALAAWPQTGCGDKNRIDGLAVTAMRQALNDIAIRGRIVIGEGEIDHAPMLWIGEEVGNGEGPEVD 80 
194444730   1 -MSLAWPLFRITEQAALAAWPQTGCGDKNRIDGLAVTAMRQALNDIAIRGRIVIGEGEIDHAPMLWIGEEVGNGEGPEVD 79 
215488227   1 MMSLAWPLFRVTEQAALAAWPQTGCGDKNKIDGLAVTAMRQALNDVAFRGRVVIGEGEIDHAPMLWIGEEVGKGDGPEVD 80 
218550172   1 MMSLAWPLFRVTEQAALAAWPQTGCGNKNKIDGLAVTAMRQALNDVAFRGRVVIGEGEIDHAPMLWIGEEVGKGDGPEVD 80 
218706443   1 MMSLAWPLFRVTEQAALAAWPQTGCGDKNKIDGLAVTAMRQALNDVAFRGRVVIGEGEIDHAPMLWIGEEVGKGDGPEVD 80 
218701641   1 MMSLAWPLFRVTEQAALAAWPQTGCGDKNKIDGLAVTAMRQALNDVAFRGRVVIGEGEIDHAPMLWIGEEVGKGDGPEVD 80 
260845600   1 MMSLAWPLFRVTEQAALAAWPQTGCGDKNKIDGLAVTAMRQALNDVAFRGRVVIGEGEIDHAPMLWIGEEVGKGDGPEVD 80 
110806836  81 IAVDPIEGTRMVAMGQSNALAVMAFAPRDSLLHAPDMYMKKLVVNRLAAGAIDLSLPLADNLRNVARALGKPLDKLRMVT 160
161506369  81 IAVDPIEGTRMVAMGQSNALAVMAFAPRGSLLHAPDMYMKKLVVSRQAKGVINLALSLTDNLRNVARALNKPLEELRMVT 160
170680034  81 IAVDPIEGTRMVAMGQSNALAVMAFAPRDSLLHAPDMYMKKLVVNRQAAGAIDLSLPLADNLRNVAKALGKPLDKLRMVT 160
194734320  81 IAVDPIEGTRMVAMGQSNALAVMAFAPRGSLLHAPDMYMKKLVVNRQAKGVINLALSLTDNLRNVARALNKPLEDLRMVT 160
194444730  80 IAVDPIEGTRMVAMGQSNALAVMAFASRGSLLHAPDMYMKKLVVNRQAKGVINLALSLTDNLRNVARALNKPLEDLRMVT 159
215488227  81 IAVDPIEGTRMVAMGQSNALAVMAFAPRDSLLHAPDMYMKKLVVNRLAVGAIDLSLPLADNLRSVARALGKPLDRLRMVT 160
218550172  81 IAVDPIEGTRMVAMGQSNALAVMAFAPRGSLLHAPDMYMKKLVVNRLAAGSIDLALPLADNLRNVARALGKPLDRLRMVT 160
218706443  81 IAVDPIEGTRMVAMGQSNALAVMAFAPRDSLLHAPDMYMKKLVVNRQAAGAIDLSLPLADNLRNVAKALGKPLDKLRMVT 160
218701641  81 IAVDPIEGTRMVAMGQSNALAVMAFAPRGSLLHAPDMYMKKLVVNRLAAGAIDLSLPLVDNLRNVAKALGKPLDKLRMVT 160
260845600  81 IAVDPIEGTRMVAMGQSNALAVMAFAPRDSLLHAPDTYMKKLVVNRLAAGAIDLSLPLADNLRNVAKALGKPLDKLRMVT 160
110806836 161 LDKPRLSAAIEEATQLGVKVFALPDGDVAASVLTCWQDNPYDVMYTIGGAPEGVISACAVKALGGDMQAELIDFCQAKGD 240
161506369 161 LDKPRLQPAITQATQLGVKVFALSDGDVAASVLTCLQDNPYDLMYTIGGAPEGVISACAVKALGGDMQAELLDFCETKGD 240
170680034 161 LDKPRLSTAIEEATQLGVKVFALPDGDVAASVLTCWQDNPYDVMYTIGGAPEGVISACAVKALGGDMQAELIDFCQAKGD 240
194734320 161 LDKPRLKPAITQATQLGVKVFALPDGDVAASVLTCLQDNPYDLMYTIGGAPEGVISACAVKALGGDMQAELLDFCEAKGD 240
194444730 160 LDKPRLKPAITQATQLGVKVFALPDGDVAASVLTCLQDNPYDLMYTIGGAPEGVISACAVKALGGDMQAELLDFCEAKGD 239
215488227 161 LDKPRLSAAIEEATQLGVKVFALPDGDVAASVLTCWHDNPYDVMYTIGGAPEGVISACAVKALGGDMQAELIDFCQAKGD 240
218550172 161 LDKPRLSAAIEEATQLGVKVFALPDGDVAASVLTCWQDNPYDVMYTIGGAPEGVISACAVKALGGDMQTELIDFCQAKGD 240
218706443 161 LDKPRLSTAIEEATQLGVKVFALPDGDVAASVLTCWQDNPYDVMYTIGGAPEGVISACAVKALGGDMQAELIDFCQAKGD 240
218701641 161 LDKPRLSAAIEEATQLGVKVFALPDGDVAASVLTCWQDNPYDVMYTIGGAPEGVISACAVKALGGDMQAQLIDFCQAKGD 240
260845600 161 LDKPRLSAAIEEATQLGVKVFALPDGDVAASVLTCWQDNPYDVMYTIGGAPEGVISACAVKALGGDMQAELIDFCQAKGD 240
110806836 241 YTENRQIAEQERKRCKAMGVDVNRVYSLDELVRGNDILFSATGVTGGELVNGIQQTANGVRTQTLLIGGADQTCNIIDSL 320
161506369 241 NADNRLVAQQERQRCEEMGVAVNRVYSLDELAAGNDILFSATGVTGGDLVNGIQRVANGVRTQTLLIGSADRTCNIIDSL 320
170680034 241 YTENRQIAEQERKRCKEMGVDVNRVYSLDELVRGNDILFSATGVTGGELVNGIQQTANGVRTQTLLIGGADQTCNIIDSL 320
194734320 241 NADNRLVAQQERQRCEEMGVAVNRVYSLDELAAGNDILFSATGVTGGDLVNGIQRVANGVRTQTLLIGSADRTCNIIDSL 320
194444730 240 NADNRLVAQQERQRCEEMGVAVNRVYSLDELAAGNDILFSATGVTGGDLVNGIQRVANGVRTQTLLIGSADRTCNIIDSL 319
215488227 241 YTENRQIAEQERKRCKAMGVDVNRVYSLDELVRGNDILFSATGVTGGELVNGIQQTANGVRTQTLLIGGADQTCNIIDSL 320
218550172 241 YTENRQIAEQERQRCKAMGVEVNRVYSLDELVKGNDILFSATGVTGGELVNGIQQTANGVRTQTLLIGGADQTCNIIDSL 320
218706443 241 YTENRQIAEQERKRCKEMGVDVNRVYSLDELVRGNDILFSATGVTGGELVNGIQQTANGVRTQTLLIGGADQTCNIIDSL 320
218701641 241 YTENRQIAEQERKRCKAMGVDVNRVYSLDELVRGNDILFSATGVTGGELVNGIQQTANGVRTQTLLIGGADQTCNIIDSL 320
260845600 241 YTENRQIAEQERKRCKAMGVDVNRVYSLDELVRGNDILFSATGVTGGELVNGIQQTANGVRTQTLLIGGADQTCNIIDSL 320
110806836 321 H 321
161506369 321 H 321
170680034 321 H 321
194734320 321 H 321
194444730 320 H 320
215488227 321 H 321
218550172 321 H 321
218706443 321 H 321
218701641 321 H 321
260845600 321 H 321
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap