Conserved Protein Domain Family
PRK12371

?
PRK12371: PRK12371 
ribonuclease III; Reviewed
Statistics
?
PSSM-Id: 171444
View PSSM: PRK12371
Aligned: 30 rows
Threshold Bit Score: 354.771
Threshold Setting Gi: 161621443
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161621443   2 AATKRLTADALAEALVERTGHAFADRQRLQRALTHASARGANAGtDYERFEFLGDRVLGLVVADMLLAAFPDAAEGELSL 81 
15964825    1 -MKGRSLNTEDRARLEAAIGYRFAEKERLDRALTHSSARSGRAI-NYQRLEFLGDRVLGLCVAELLFQTFTDANEGELSV 78 
159184588   1 MSKTKPLSADEISRLEALIGYEFKEKARLDRALTHASARSAAAG-NYERLEFLGDRVLGLCVAELLFSTFRNASEGELSV 79 
150395906   1 -MKGRSLNAEDRARLEAAIGYQFAEKERLDRALTHSSARSGRAI-NYQRLEFLGDRILGLCVAELLFQTFSDANEGELSV 78 
86357028    1 MSKAQTLSAADRAKLEALIGHDFAEKERLDRALTHASARTEKGS-NYERLEFLGDRVLGLCIAELLFRTFGTAGEGELSV 79 
190891073   1 MSKAQTLSAADRAKLESLIGHDFAEKERLDRALTHASARTEKGS-NYERLEFLGDRVLGLCIAELLFRTFGTAGEGELSV 79 
209548601   1 MSKAQTLSAADRAKLEGLIGHDFAEKERLDRALTHASARTEKGG-NYERLEFLGDRVLGLCIAELLFRTFGTAGEGELSV 79 
222085390   1 MTKTPTLSQADRLTLEAAIGHAFVEKERLDWALTHASARTHKAG-NYERLEFLGDRVLGLCIAELLFRTFGTATEGELSV 79 
227821403   1 MMKGRSLSAEDRARLETAIGYQFAEKERLDRALTHSSARNARAS-NYQRLEFLGDRVLGLCVAELLFQTFLDANEGELSV 79 
241203889   1 MSKAQTLSAADRAKLEALIGHDFAEKERLDRALTHASARTEKGG-NYERLEFLGDRVLGLCIAELLFRTFGTAGEGELSV 79 
161621443  82 RLNALVNAEALSEIAEHIGLPDLIRAGSDVRGLEGRKRVNLRADALESLIAVLYLDGGLEAARAFIHKYWQPRSQASGAA 161
15964825   79 RLNQLVSAESCAKVADELSLHEFIRTGSDVKKITGKHMMNVRADVVESLIAAIYLDGGLDAARRFVLEHWTHRAASADGA 158
159184588  80 RLNQLVSAESCAAIGDEMGLHNFIRTGSDVKKLTGKAMLNVRADVVESLIATLYLDGGLEASRKFILKYWQGRATSVDAG 159
150395906  79 RLNQLVSAESCAKVADELSLHEFIRTGSDVKKITGKHMMNVRADVVESLIAAIYLDGGLEAARRFVLEHWTHRAASADGA 158
86357028   80 RLNQLVSAETCAAVADELNLHLYIRTGADVKKLTGKRMMNVRADVVESLIAAIYLDGGLEVARRFILRYWQGRAVRADGA 159
190891073  80 RLNQLVSAETCAAVADELNLHLYIRTGADVKKLTGKRMMNVRADVVESLIAAIYLDGGLEVARRFILRYWQGRAVRADGA 159
209548601  80 RLNQLVSAETCAAVADELNLHLYIRTGADVKKLTGKRMMNVRADVVESLIAAIYLDGGLEVARRFILRYWQGRAVRADGA 159
222085390  80 RLNQLVSAETCAAVADEMQLHLFIRTGADVKKLTGKRMLNVRADVVESLIAALYLDGGLEVARKFILRYWEGRAVRPDGA 159
227821403  80 RLNQLVSAESCARVADELSLHEYIRTGSDVKKITGKHMMNVRADVVESLIAAIYLDGGLEAARRFVLRHWTDRAASADGA 159
241203889  80 RLNQLVSAETCAAVADELNLHLYIRTGADVKKLTGKRMMNVRADVVESLIAAIYLDGGLEVARRFILRYWQGRAVRADGA 159
161621443 162 RRDAKTELQEWAHQAASAVPAYQIDSREGPDHDPLFTVSVRVGAFQPATGSGRSKREAEQAAAAALLLREGVWNAA 237
15964825  159 RRDAKTELQEWAHAKFGVAPKYRTDDRSGPDHDPRFTVTVEVDGIAPETGVDRSKRGAEQVAAMKLLEREGVWQKR 234
159184588 160 RRDAKTELQEWAHARFAATPAYRVDDRSGPDHDPSFTVTVEIPGVKPETGVERSKRAAEQVAATRLLEREGVWRKS 235
150395906 159 RRDAKTELQEWAHARFGVAPKYRTEDRSGPDHDPRFTVTVEVDGIDPETGVDRSKRGAEQVAAMKLLEREGVWQKR 234
86357028  160 KRDAKTELQEWSHAKFGVTPIYRVDERSGPDHDPRFRVTVEVAGIKPESGVERSKRAAEQVAATKMLEREGIWQQS 235
190891073 160 KRDAKTELQEWSHAKFGVTPLYRVDERSGPDHDPRFKVTVEVAGIKPETGVERSKRAAEQVAATKMLEREGIWQQS 235
209548601 160 KRDAKTELQEWSHAKFGVTPNYRVDERSGPDHDPRFKVTVEVAGIKPETGVERSKRAAEQVAATKMLEREGIWQQS 235
222085390 160 RRDAKTELQEWAHAKFGVTPVYRVDDRSGPDHDPRFTVTVEVAGAAPETGIERSKRAAEQVAATRILEREGIWQPQ 235
227821403 160 RRDAKTELQEWAHAKFGAAPRYRTDDRSGPDHDPRFTVTVEVDGIAPETGTDRSKRGAEQIAAMRLLEREGVWQKR 235
241203889 160 KRDAKTELQEWSHAKFGVTPIYRVDERSGPDHDPRFKVTVEVAGIKPETGVERSKRAAEQVAATKMLEREGIWQQS 235
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap