Conserved Protein Domain Family
PRK12369

?
PRK12369: PRK12369 
putative transporter; Reviewed
Statistics
?
PSSM-Id: 171443
View PSSM: PRK12369
Aligned: 15 rows
Threshold Bit Score: 469.55
Threshold Setting Gi: 71083699
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
57237187    1 MFSSFFKSKKWALWAYLGLFLLLFFLYIQTSLNVAINSWYSDFYNVLQKPKielldsnstqkieenlennatliqeanqr 80 
59713856    1 MFRCFFLNRKWFFWSIYGTTAVVAVNWFRVGIDVELNYWNGHFYDLIQEAL----------------------------- 51 
51246815    1 MFKSFFMDKKWALWAYGGAIFLLLALFVQVELTVKINQWYGAFYDLLQKAE----------------------------- 51 
118474457   1 MFSSFFKSKKWSLWAYGGLLVIVISLVLQTRLNVAINDWYKNFYDILQNVK----------------------------- 51 
120610885   1 MFKSFFLARRWWAWSIAGSVFILLATWYRVELDVQINDWFGSFYDLIQTSL----------------------------- 51 
157164675   1 MFSSFFKDKKWALWAYGGAIFIILLLVYQTHLNVRINEWYKNFYDIVQNSK----------------------------- 51 
154174375   1 MFSSFFRSRRWALWAYGGAVFIILLLVYQTHLNVRINEWYKDFYDIMQNVK----------------------------- 51 
154147873   1 MFKSFFASKKWALWAYGGALFIILLLVYQTHLNVRINEWYQEFYDIMQNVK----------------------------- 51 
154173696   1 MLSSFFANKKWALWAYAGLAFLIGSLYVQVQLSVAINNWYKSFYDIVGNPElnatkaeildkdrsfsllfkdvdkdeekp 80 
157414491   1 MFSSFFASKKWALWAYLGLFLLLFFLYIQTSLNVAINSWYSDFYNVLQKPKielldsnstqkieenlennttliqeanqr 80 
57237187   81 aeqnfqkanfinkgalyyyqnlleyffnsramIEKPNYSASDFYALILVFLAIAIPYVLIATINIYFASVYAFKWREAMT 160
59713856   52 --------------------------------VSPNAVKFVDFRNVIFDFFKITTMYVVISVVVDYFVRHWIFRWRCAMN 99 
51246815   52 ------------------------------------EHTVDEFWASMKHFSFIAFPYVLIATLTSYFTRIYSFKWREAMT 95 
118474457  52 ------------------------------------EHSIDEFWAGIWKFLFIAMPYVIIATLTNFFASHWVFRWREAMT 95 
120610885  52 --------------------------------GRPGSITAGQFWGQLSSFSRIAMVYVTTAVVVDFFCKHYIFRWRQAMN 99 
157164675  52 ------------------------------------DHKVDEFWREILNFIKIAMPYVVTYTVISFFASHWVFRWREAMT 95 
154174375  52 ------------------------------------DHKIEEFWAAILQFIYIAMPYVITYMIISFFASHWVFRWREAMT 95 
154147873  52 ------------------------------------DHNVSEFWHYIMLFLQIAMPYVVTYMVVAFFASHWVFRWRKAIT 95 
154173696  81 ngsqyrsaqtnknanldknssqntpakmmaaqKNKQKYTLLDFWQSMINFAWIAFPYVLLATLTGYFTRVWAFKWREAMT 160
157414491  81 aeqnfqkanfinkgalyyyqnlleyffnsramIEKPNYSANDFYALILVFLAIAIPYVLIATINIYFASVYAFKWREAMT 160
57237187  161 FSYLKFWKNKDDnIEGSSQRIQEDTYNFSKIVESLGLSFIKALMTLVAFIPILWSLSDVVS-KAlfanlsenssfyFLKN 239
59713856  100 EHYTKHWPLIRQ-IEGASQRIQEDTMRFAKLVEDLGISILRNFMTLATFIPLLWELSKHVKvIP------------FFGG 166
51246815   96 FSYISKWQTVEEeVEGSSQRIQEDIYRFARIFESLGLQVTRAIMTLFAFLPILWGLSSGVD-LP------------YLRD 162
118474457  96 FSYVDIWRKCEQdIEGSSQRMQEDVYRFAKITETLGLQVLRAIMILIAFIPVLWGLSKGVD-VP------------IIKD 162
120610885 100 EHYMAAWPRLRH-IEGAAQRVQEDTMRFASTMEGLGLTFLRSLMTLGAFVPVLWVLSDKLTgLP------------VIGA 166
157164675  96 FKYLKFWRNCQNdIEGSSQRIQEDVYRFAKIMESLGVQVLKAFMTLIAFIPVLWELSKSVS-LP------------FIKD 162
154174375  96 FDYLEFWQRCKKeIEGSSQRIQEDVYRFAKIMESLGVQVLRATMTLIAFIPVLWALSAKVD-LP------------YIKD 162
154147873  96 FSYLGFWRNCKNdIEGSSQRIQEDIYRFGKIMEDLGVKVLRAVMTLIAFVPVLWILSEKMT-LP------------YLKD 162
154173696 161 FDYIKYWRNVEReIEGSSQRIQEDIYRFARIVESLGLQVVRAIMKLIAFLPILWGLSSSVA-LP------------FIKD 227
157414491 161 FSYLKFWKNKDDnIEGSSQRIQEDTYNFSKIVESLGLSFIKALMTLVAFIPILWSLSDVVS-KAlfanlsenssfyFLKN 239
57237187  240 IDGLLVYIALLISLGGLVVSWFVGIKLPGLEYNNQKAEAAFRKELVYAEDNRKEyAKNETMIELFTGLKFNYKRLFLHYG 319
59713856  167 VEHSMVIVAVVSSFGGIAFLMFIGRKLPAYEYNNQKVEAAFRKELVLGEDDESR-ATPKGLKELFDDVRHNYFSMYRAYL 245
51246815  163 IPGSLVWVALVVSLGGLVISWFVGIKLPGLEYNNQKIEAAFRKELVYAEDDKVNyGKTCTLVELFVGLKFNYNRLFLHYG 242
118474457 163 IPGSLVWVALIVSVGGLVISWFVGIKLPKLEYNIQRSEAAFRKELVYAEDDKINyAKNESVVELFTGLRINFYRLFLHYG 242
120610885 167 VPHSLVWVALFWALGGTVLLAVVGVRLPGLEFHNQRVEAAYRKELVLGEDDHAR-AAPPAAAALFADVRRNYFRLFFNYL 245
157164675 163 IEGSLVYIALLISIGGLIVSWFVGIKLPHLEYNNQKAEAAFRKELVYGEDDKLKfCQPNVMLELFTGVKLNYYKLFLHYG 242
154174375 163 IPGSLVFIALGISVGGLIISWFVGIKLPSLEYNNQKVEAAFRKELVYGEDDKINhSGSQTILELFTGLKFNYYRLFLHYG 242
154147873 163 IPGSLVWTALGISLGGLVISWFVGIKLPHLEYNNQKVEAAFRKELVLAENNKANfGRPETVMELFTGLKFNYYRLFLHYG 242
154173696 228 YEGSLVWIALLVSVGGLAISWFVGILLPGLEYNNQKVEAAFRKELVYGEDDKKNhAGVETLTELFTGLRFNYNRLFLHYG 307
157414491 240 IDGLLVYIALLISLGGLVVSWFVGIKLPGLEYNNQKAEAAFRKELVYAEDNRKEyAKNETMIELFTGLKFNYKRLFLHYG 319
57237187  320 YFNIWLILFEQMIVIVPFLIIAPGLFAGAIGLGIVMQINNAFDQVRSSFSVFITNWTTITQLRSIYKRLKEFEKNISYKS 399
59713856  246 WFDSCSSAYSKYSELTVYIFMSPTILQAAITLGVLKQITSSYSKVESSLRFLIRRWSSCVELMSIYKRLRAFEMQIEIFS 325
51246815  243 YFDIWVNFFEQLMIITPYLIMATGLFTGLITLGVLVQVSNAFSKVRESFSIFIANWTTITELRSIHKRLREFEHNIGY-- 320
118474457 243 YFNIWLISFSQFMVIVPFMIMGAGLFTGLITLGILVQVSNAFDQVRSSFSVFIDNWTTITELRSIHKRLDEFEKNIKFKG 322
120610885 246 YFDVVKWSYLQVSVLVPLVALGPTLIAGVITLGVMQQISRAFDRVLESFQFLVQNWSTVVEQISIHKRLRAFERQMLADT 325
157164675 243 YFNLWLISFSQILVIVPYIIMGNGLFSGVITLGVLIQASNAFSQVRESFSVFIDNWTTITELRSVNKRLREFERNIDYKA 322
154174375 243 YFNIWLISFSQILVIVPYVIMGNGLFSGVITLGILVQVSNAFSQVRESFSVFIDNWTTITELRSIYKRLKEFEQNIEYKP 322
154147873 243 YFNIWLISFSQFLVIVPYMLMGNGLFTDVITLGVLVQVSNAFSQVRESFSVFIENWTTITELRSIFKRLDEFEINIGYKN 322
154173696 308 YFDIWINFFSQLMVIVPLLIMAPGIFTGIITLGSLMQVNNAFSQVRMSFSLFINNWTTITELRSIHKRLKEFEINIGYRH 387
157414491 320 YFNIWLILFEQMIVIVPFLIMAPGLFAGAIGLGIVMQINNAFDQVRSSFSVFITNWTTITQLRSIYKRLKEFEKNISYKS 399
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap