Conserved Protein Domain Family
PRK12365

?
PRK12365: PRK12365 
ribonucleoside-diphosphate reductase subunit alpha
Statistics
?
PSSM-Id: 171440
View PSSM: PRK12365
Aligned: 14 rows
Threshold Bit Score: 2173.17
Threshold Setting Gi: 15618892
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15605562     1 MVDLQEKQCTIVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVVQKITDGQVVTVERI 80  
62185357     1 MVEVKEKHYTVVKRNGMFVPFNQERIFQALEAAFRDTRSLENDSPLPKDLENAISDITHRVVNEVIQKIREGQVVTVERI 80  
15618892     1 MVEVEEKHYTIVKRNGMFVPFNQDRIFQALEAAFRDTRSLETSSPLPKDLEESIAQITHKVVKEVLAKISEGQVVTVERI 80  
16752044     1 MVEVEEKHYTIVKRNGMFVPFNQDRIFQALEAAFRDTRSLETSSPLPKDLEESIAQITHKVVKEVLAKISEGQVVTVERI 80  
76789572     1 MVDLQEKQCTIVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVVQKITDGQVVTVERI 80  
89898044     1 MVEVKEQHYTIVKRNGMFVPFNQDRIFQALEAAFRDTRSLEDTSPLPKDLEKSISSITRQVVNEVVQKIREGQVVTVERI 80  
15836515     1 MVEVEEKHYTIVKRNGMFVPFNQDRIFQALEAAFRDTRSLETSSPLPKDLEESIAQITHKVVKEVLAKISEGQVVTVERI 80  
29840534     1 MVEVKEKNYTIVKRNGMFVPFNQDRISQALEAAFRDTRSLENNSPLPEDLENSISDITHRVVNEVMQKIREGQVVTVERI 80  
166155046    1 MVDLQEKQCTIVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVVQKITDGQVVTVERI 80  
237803259    1 MVDLQEKQCTIVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHMPLPEDLESSIRSITHQVVKEVVQKITDGQVVTVERI 80  
15605562    81 QDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREE 160 
62185357    81 QDMVENQLYVNGLQDVARDYIIYRDHHKEQREGSWHCVSVIRRDGSTVKFNPMKISAALEKAFRATQKITDVSIQEILSE 160 
15618892    81 QDLVESQLYISGLQDVARDYIVYRDQRKAERGNSSSIIAIIRRDGGSAKFNPMKISAALEKAFRATLQINGMTPPATLSE 160 
16752044    81 QDLVESQLYISGLQDVARDYIVYRDQRKAERGNSSSIIAIIRRDGGSAKFNPMKISAALEKAFRATLQINGMTPPATLSE 160 
76789572    81 QDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREE 160 
89898044    81 QDMVENQLYVSGMQDVARNYIIYRDQHKERRKGSWHSVSVMRRDGNLVRFNPMKISAALEKAFRATLKITDVLLQEILSE 160 
15836515    81 QDLVESQLYISGLQDVARDYIVYRDQRKAERGNSSSIIAIIRRDGGSAKFNPMKISAALEKAFRATLQINGMTPPATLSE 160 
29840534    81 QDMVENQLYVNGLQDVARDYIVYRDQHKEQREGSWHCVLVRRRDGNAVKFNPMKISAALEKAFRATQKNTDTPFQETLAE 160 
166155046   81 QDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREE 160 
237803259   81 QDMVESQLYVNGLQDVARDYIVYRDDRKAHRKKSWQSLSVVRRCGTVVHFNPMKISAALEKAFRATDKTEGMTPSSVREE 160 
15605562   161 INALTQNIVAEIEECCPQQDRrIDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEdGSTEKTIAEEAVEVL 240 
62185357   161 INGLTNKIVEEILGVCSPEKT-IDIEVIQDIVEKQLMVVGHYDVAKNYILYREARSRIRENKQQ-IDAQKDLVEEVYDVV 238 
15618892   161 INDLTLRIVEDVLSLHGEEA--INLEEIQDIVEKQLMVAGYYDVAKNYILYREARARARANKDQdGQEEFVPQEETYVVQ 238 
16752044   161 INDLTLRIVEDVLSLHGEEA--INLEEIQDIVEKQLMVAGYYDVAKNYILYREARARARANKDQdGQEEFVPQEETYVVQ 238 
76789572   161 INALTQNIVAEIEECCPQQDRrIDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEdGSTEKTIAEEAVEVL 240 
89898044   161 INNLTNKIVEETLAKCSREQT-IDIEAIQDIVETQLMIAGHYDVAKNYILYREARSRIREHKQE-IAVQEEIVEEVYDVV 238 
15836515   161 INDLTLRIVEDVLSLHGEEA--INLEEIQDIVEKQLMVAGYYDVAKNYILYREARARARANKDQdGQEEFVPQEETYVVQ 238 
29840534   161 INDLTNKIVEEILVVCSQEKT-VDIEVIQDIVEKQLMVVGHYDVAKNYILYREARSRIRESKENvATQESI--EEVYDVV 237 
166155046  161 INALTQNIVAEIEECCSQQDRrIDIEKIQDIVEQQLMVVGHYAIAKNYILYREARARVRDNREEdGSTEKTIAEEAFEVL 240 
237803259  161 INALTQNIVAEIEECCPQQDRrIDIEKIQDIVEQQLMVVGHYAVAKNYILYREARARVRDNREEdGSTEKTIAEEAVEVL 240 
15605562   241 SKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVVLACIMAARANIEKEPDYAFVAAELLLDV 320 
62185357   239 KSDGTTYSINKSQLIDKFIWACQRFPETTDPQVLADMAFANFYSGIKESEIALACIMAARANIEKEPDYAYVAAELLMDV 318 
15618892   239 KEDGTTYLLRKTDLEKRFSWACKRFPKTTDSQLLADMAFMNLYSGIKEDEVTTACIMAARANIEREPDYAFIAAELLTSS 318 
16752044   239 KEDGTTYLLRKTDLEKRFSWACKRFPKTTDSQLLADMAFMNLYSGIKEDEVTTACIMAARANIEREPDYAFIAAELLTSS 318 
76789572   241 SKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVVLACIMAARANIEKEPDYAFVAAELLIDV 320 
89898044   239 KSDGTTYQINKAQLTEKFVWACRRFPKTTNPHTLADMAFANFYSGIKESEIVLACIMAARANIEKEPDYAYVAAELLLDV 318 
15836515   239 KEDGTTYLLRKTDLEKRFSWACKRFPKTTDSQLLADMAFMNLYSGIKEDEVTTACIMAARANIEREPDYAFIAAELLTSS 318 
29840534   238 REDGSTYQINKAQLTDKFIWACQRFPETTNPQTLASMAFANFYSGIKEAEIVKACIMAARANIEKEPDYAYVAAELLTDV 317 
166155046  241 SKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVVLACIMAARANIEKEPDYALVAAELLLDV 320 
237803259  241 SKDGSTYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVVLACIMAARANIEKEPDYAFVAAELLLDV 320 
15605562   321 VYKEALGKSKYAEDLEQAHRDHFKRYIAEGDTYRLNAELKHlFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCR 400 
62185357   319 VYQEAMGKTATDSDLAEAQKQCFKNYILNGETYRLNPRLKE-YDLDALAEALDISRDQKFSYMGVQNLYDRYFNQHEGLR 397 
15618892   319 LYEETLGCSSQDPNLSEIHKKHFKEYILNGEEYRLNPQLKD-YDLDALSEVLDLSRDQQFSYMGVQNLYDRYFNLHEGRR 397 
16752044   319 LYEETLGCSSQDPNLSEIHKKHFKEYILNGEEYRLNPQLKD-YDLDALSEVLDLSRDQQFSYMGVQNLYDRYFNLHEGRR 397 
76789572   321 VYKEALGKSKYAEDLEQAHRDHFKRYIAEGDTYRLNAELKHlFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCR 400 
89898044   319 VCQEAIGKSIMDADLVEAHKQYFKQYILDGDQYRLNPRLKE-YDLDALAEALDISRDHQFSYMGVQTLYDRYLNQYEGRR 397 
15836515   319 LYEETLGCSSQDPNLSEIHKKHFKEYILNGEEYRLNPQLKD-YDLDALSEVLDLSRDQQFSYMGVQNLYDRYFNLHEGRR 397 
29840534   318 VYQETMGKSATDSDLAEAQKQCFKNYILNGEEYRLNPRLKE-YDLDALAEALDISRDRQFSYMGVQNLYDRYFNQHEGRR 396 
166155046  321 VYKEALGKSKYAEDLEQAHRDHFKRYIAEGDTYRLNAELKHlFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCR 400 
237803259  321 VYKEALGKSKYAEDLEQAHRDHFKRYIAEGDTYRLNAELKHlFDLDALADAMDLSRDLQFSYMGIQNLYDRYFNHHEGCR 400 
15605562   401 LETPQIFWMRVAMGLALNE-QDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDNLVNIYKVIADNAM 479 
62185357   398 VETAQIFWMRVSMGLALNEgDDKTFWAITFYNLLSTFRYTPATPTLFNSGTRHSQLSSCYLSTIQDDLAHIYKVISDNAM 477 
15618892   398 LETAQIFWMRVSMGLALNEgEQKNFWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVKDDLSHIYKVISDNAL 477 
16752044   398 LETAQIFWMRVSMGLALNEgEQKNFWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVKDDLSHIYKVISDNAL 477 
76789572   401 LETPQIFWMRVAMGLALNE-QDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDNLVNIYKVIADNAM 479 
89898044   398 LETTQIFWMRVSMGLALNEgEDKTSWAITFYNLLSSFRYTPATPTLFNSGMRHSQLSSCYLSTVQDDLAHIYKVISDNAM 477 
15836515   398 LETAQIFWMRVSMGLALNEgEQKNFWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVKDDLSHIYKVISDNAL 477 
29840534   397 LETAQIFWMRISMGLALNEgEDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDDLAHIYKVISDNAM 476 
166155046  401 LETPQIFWMRVAMGLALNE-QDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDDLVNIYKVIADNAM 479 
237803259  401 LETPQIFWMRVAMGLALNE-QDKTSWAITFYNLLSTFRYTPATPTLFNSGMRHSQLSSCYLSTVQDNLVNIYKVIADNAM 479 
15605562   480 LSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAVNQGGKRKGAVCVYLEVWHLDYEDFLELRKNTGDE 559 
62185357   478 LSKWAGGIGNDWTGVRATGSLIKGTNGKSQGVIPFIKVANDTAIAVNQGGKRKGATSVYLETWHLDYEDFLELRKNTGDE 557 
15618892   478 LSKWAGGIGNDWTDVRATGAVIKGTNGKSQGVIPFIKVANDTAIAVNQGGKRKGAMCVYLENWHLDYEDFLELRKNTGDE 557 
16752044   478 LSKWAGGIGNDWTDVRATGAVIKGTNGKSQGVIPFIKVANDTAIAVNQGGKRKGAMCVYLENWHLDYEDFLELRKNTGDE 557 
76789572   480 LSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAVNQGGKRKGAVCVYLEVWHLDYEDFLELRKNTGDE 559 
89898044   478 LSKWAGGIGNDWTGVRATGSLIKGTNGKSHGVIPFIKVANDTAVAVNQGGKRKGATCVYLETWHLDYEDFLELRKNTGDE 557 
15836515   478 LSKWAGGIGNDWTDVRATGAVIKGTNGKSQGVIPFIKVANDTAIAVNQGGKRKGAMCVYLENWHLDYEDFLELRKNTGDE 557 
29840534   477 LSKWAGGIGNDWTGVRAIGSLIKGTNGKSQGVIPFIKVANDTAIAVNQGGKRKGAMCVYLEIWHLDYEDFLELRKNTGDE 556 
166155046  480 LSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAVNQGGKRKGAVCVYLEVWHLDYEDFLELRKNTGDE 559 
237803259  480 LSKWAGGIGNDWTAIRATGALIKGTNGRSQGVIPFIKVTNDTAVAVNQGGKRKGAVCVYLEVWHLDYEDFLELRKNTGDE 559 
15605562   560 RRRAHDVNIASWIPDLFFKRLQQKGTWTLFSPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSM 639 
62185357   558 RRRTHDINTASWIPDLFFKRLEQQGMWTLFSPDDVPGLHEAYGTEFDKLYEEYESKIDTGEIKLYKKIPAADLWRKMLSM 637 
15618892   558 RRRTHDINTASWIPDLFFKRLEKKGMWTLFSPDDVPGLHEAYGLEFEKLYEEYERKVESGEIRLYKKVEAEVLWRKMLSM 637 
16752044   558 RRRTHDINTASWIPDLFFKRLEKKGMWTLFSPDDVPGLHEAYGLEFEKLYEEYERKVESGEIRLYKKVEAEVLWRKMLSM 637 
76789572   560 RRRAHDVNIASWIPDLFFKRLQQKGTWTLFSPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSM 639 
89898044   558 RRRTHDINTASWIPDLFFKRLEQKGTWTLFSPDDVPGLHEAYGFEFDKLYEEYERKVDTGEIKLYKKIPAEDLWRKMLSM 637 
15836515   558 RRRTHDINTASWIPDLFFKRLEKKGMWTLFSPDDVPGLHEAYGLEFEKLYEEYERKVESGEIRLYKKVEAEVLWRKMLSM 637 
29840534   557 RRRTHDINTASWIPDLFFKRLDQKGTWTLFSPDDVPGLHEAYGFEFDKLYEEYERKIDNGEIKLYKKIPAEDLWRKMLSM 636 
166155046  560 RRRAHDVNTASWIPDLFFKRLQQKGTWTLFSPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSM 639 
237803259  560 RRRAHDVNIASWIPDLFFKRLQQKGTWTLFSPDDVPGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSM 639 
15605562   640 LFETGHPWMTFKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDEEKLSETISIAVRML 719 
62185357   638 LYETGHPWMTFKDPSNIRAVQDHVGVVRCSNLCTEILLNCSENETAVCNLGSVNLVEHIENGDINEKKLEETISIAIRIL 717 
15618892   638 LYETGHPWITFKDPSNIRSNQDHVGVVRCSNLCTEILLNCSESETAVCNLGSINLVEHIRNDKLDEEKLKETISIAIRIL 717 
16752044   638 LYETGHPWITFKDPSNIRSNQDHVGVVRCSNLCTEILLNCSESETAVCNLGSINLVEHIRNDKLDEEKLKETISIAIRIL 717 
76789572   640 LFETGHPWMTFKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDEEKLSETISIAVRML 719 
89898044   638 LYETGHPWITFKDPSNIRSAQDHAGVVRCSNLCTEILLNSSESETAVCNLGSVNLVEHIKNGDIDEEMLGETISIAIRIL 717 
15836515   638 LYETGHPWITFKDPSNIRSNQDHVGVVRCSNLCTEILLNCSESETAVCNLGSINLVEHIRNDKLDEEKLKETISIAIRIL 717 
29840534   637 LYETGHPWLTFKDPSNIRGAQDHAGVVRCSNLCTEILLNCSENETAVCNLGSVNLVEHIENGDINEKKLAETISIAIRIL 716 
166155046  640 VFETGHPWMTFKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDEEKLSETISIAVRML 719 
237803259  640 LFETGHPWMTFKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINLVQHIVGDGLDEEKLSETISIAVRML 719 
15605562   720 DNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEFADYSSELISYYAIQASCLLAKERGTYSSYK 799 
62185357   718 DNVIDLNFYPTQEAANANLSHRAIGLGIMGFQDALYKLNISYASPEAVEFADKSSELVAYYAILSSSLLAKERGTYSSYK 797 
15618892   718 DNVIDLNFYPTPEAKQANLTHRAVGLGVMGFQDVLYELNISYASQEAVEFSDECSEIIAYYAILASSLLAKERGTYASYS 797 
16752044   718 DNVIDLNFYPTPEAKQANLTHRAVGLGVMGFQDVLYELNISYASQEAVEFSDECSEIIAYYAILASSLLAKERGTYASYS 797 
76789572   720 DNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEFADYSSELISYYAIQASCLLAKERGTYSSYK 799 
89898044   718 DNVIDINFYPTQEAANANLTHRAVGLGMMGFQDALYKLNISYASPEAVEFADKSSELIAYYALLSSSLLAKERGTYSSYK 797 
15836515   718 DNVIDLNFYPTPEAKQANLTHRAVGLGVMGFQDVLYELNISYASQEAVEFSDECSEIIAYYAILASSLLAKERGTYASYS 797 
29840534   717 DNIIDLNFYPTPEAANANLSHRAVGLGQMGFQDALYKLNISYASQEAVEFADKSAELIAYYAILSSSLLAKERGTYSSYK 796 
166155046  720 DNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEFADYSSELISYYAIQASCLLAKERGTYSSYK 799 
237803259  720 DNVIDINFYPTKEAKEANFAHRAIGLGVMGFQDALYKLDISYASQEAVEFADYSSELISYYAIQASCLLAKERGTYSSYK 799 
15605562   800 GSKWDRGLLPIDTIQLLANYRGEANLQMDTSSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLF 879 
62185357   798 GSKWDRGYLPLDTIELLKEYRGEENVLMDTSCRKDWTPVREAIKSYGMRNSHTMAIAPTATISNIIGVTQSIEPTYKHLF 877 
15618892   798 GSKWDRGYLPLDTIELLKETRGEHNVLVDTSSKKDWTPVRDTIQKYGMRNSQVMAIAPTATISNIIGVTQSIEPMYKHLF 877 
16752044   798 GSKWDRGYLPLDTIELLKETRGEHNVLVDTSSKKDWTPVRDTIQKYGMRNSQVMAIAPTATISNIIGVTQSIEPMYKHLF 877 
76789572   800 GSKWDRGLLPIDTIQLLANYRGEANLQMDTSSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLF 879 
89898044   798 GSKWDRGYLPIDTIELLKEYRGEDKLLMDTSCRKDWAPVREAIKSYGMRNSHTMAIAPTATISNIIGVTQSIEPTYKHLF 877 
15836515   798 GSKWDRGYLPLDTIELLKETRGEHNVLVDTSSKKDWTPVRDTIQKYGMRNSQVMAIAPTATISNIIGVTQSIEPMYKHLF 877 
29840534   797 GSKWDRGYLPLDTVELLKEYRGEENVLMDTSCRKDWTPVREAIKAYGMRNSHTMAIAPTATISNIIGVTQSIEPTYKHLF 876 
166155046  800 GSKWDRGLLPIDTIQLLANYRGEANLQMDTSSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLF 879 
237803259  800 GSKWDRGLLPIDTIQLLANYRGEANLQMDTSSRKDWEPIRSLVKEHGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLF 879 
15605562   880 VKSNLSGEFTIPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWIIECASRRQKWIDMG 959 
62185357   878 VKSNLSGEFTIPNVYLISKLKELGLWDDDMLDDLKYFDGSLLEIERIPDDLKKIFLTAFEIEPEWLIECASRRQKWIDMG 957 
15618892   878 VKSNLSGEFTIPNTYLIKKLKELGLWDAEMLDDLKYFDGSLLEIERIPNHLKKLFLTAFEIEPEWIIECTSRRQKWIDMG 957 
16752044   878 VKSNLSGEFTIPNTYLIKKLKELGLWDAEMLDDLKYFDGSLLEIERIPNHLKKLFLTAFEIEPEWIIECTSRRQKWIDMG 957 
76789572   880 VKSNLSGEFTIPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWIIECASRRQKWIDMG 959 
89898044   878 VKSNLSGEFTIPNVYLIEKLKQLGLWDADMLDDLKYFDGSLLEIERIPDDLKKIFLTAFEIEPEWLIECASRRQKWLDMG 957 
15836515   878 VKSNLSGEFTIPNTYLIKKLKELGLWDAEMLDDLKYFDGSLLEIERIPNHLKKLFLTAFEIEPEWIIECTSRRQKWIDMG 957 
29840534   877 VKSNLSGEFTIPNVYLIEQLKKLGIWDADMLDDLKYFDGSLLEIERIPDDLKKIFLTAFEIEPEWLIECASRRQKWIDMG 956 
166155046  880 VKSNLSGEFTIPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWIIECASRRQKWIDMG 959 
237803259  880 VKSNLSGEFTIPNVYLIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEWIIECASRRQKWIDMG 959 
15605562   960 QSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSFVDINKRGIQPRWMKNKSASAGIIVERAKKAPVCSL 1039
62185357   958 QSLNLYLSEPNGKKLSAMYLTAWKKGLKTTYYLRSSAATSVEKSFTDINKRGIQPRWMKNKSASTSIVVDRAKKTPVCSF 1037
15618892   958 VSLNLYLAEPDGKKLSNMYLTAWKKGLKTTYYLRSQAATSVEKSFIDINKRGIQPRWMKNKSASTSIVVER-KTTPVCSM 1036
16752044   958 VSLNLYLAEPDGKKLSNMYLTAWKKGLKTTYYLRSQAATSVEKSFIDINKRGIQPRWMKNKSASTSIVVER-KTTPVCSM 1036
76789572   960 QSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSFVDINKRGIQPRWMKNKSASAGIIVERAKKAPVCSL 1039
89898044   958 QSVNLYLSEPNGKKLSAMYLTAWKKGLKTTYYLRSLAATSVEKSFIDINKRGIQPRWMKNKSASTSIVVERTRETPVCSL 1037
15836515   958 VSLNLYLAEPDGKKLSNMYLTAWKKGLKTTYYLRSQAATSVEKSFIDINKRGIQPRWMKNKSASTSIVVER-KTTPVCSM 1036
29840534   957 QSLNLYLSEPNGKKLSAMYLTAWKKGLKTTYYLRSLAATSVEKSFTDVNKRGIQPRWMKNKSASTSIVVERTKSTPVCSL 1036
166155046  960 QSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSFVDINKRGIQPRWMKNKSASAGIIVERAKKAPVCSL 1039
237803259  960 QSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRSSSATTVEKSFVDINKRGIQPRWMKNKSASAGIIVERAKKAPVCSL 1039
15605562  1040 EEGCEACQ 1047
62185357  1038 EEGCESCQ 1045
15618892  1037 EEGCESCQ 1044
16752044  1037 EEGCESCQ 1044
76789572  1040 EEGCEACQ 1047
89898044  1038 EEGCESCQ 1045
15836515  1037 EEGCESCQ 1044
29840534  1037 EEGCESCQ 1044
166155046 1040 EEGCEACQ 1047
237803259 1040 EEGCEACQ 1047
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap