Conserved Protein Domain Family
PRK12363

?
PRK12363: PRK12363 
phosphoglycerol transferase I; Provisional
Statistics
?
PSSM-Id: 171438
View PSSM: PRK12363
Aligned: 8 rows
Threshold Bit Score: 1113.44
Threshold Setting Gi: 146313151
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
78046002    1 MHWMLLVSLLLLLWLLVASPRLAWLKAGLLSLFLLLLSVWGLVDRLSGDGINAATLYHLRADMDGAGVSDFSGYIAVFVG 80 
161485718   1 MHWMLLVSLLLLLWLLVASPRLAWLKAGLLSLFLLLLSAWGLVDRLSGDGINAATLYHLRADMDGAGVSDFSGYIAVFVG 80 
161485703   1 MHWILALSLLLLLLLLVASPRLAWLKAGLLSLLLLLLSAWGLVDRLSGDGVNAATLYHLRADMDGAGVSDFSGYIAVFIG 80 
162017110   1 MHWILALSLLLLLLLLVASPRLAWLKAGLLSLLLLLLSAWGLVDRLSGDGVNAATLYHLRADMDGAGVSDFSGYIAVFIG 80 
146313151   1 MDYLF---LALLIVTAFASASFLRTKALTTVAFILVFAFWYICNMFTGNGVTDAVYYHLKINVTGTSIDDILPKIYAAII 77 
188989830   1 MHWILALSLLLLLWLLVASPRLAWLKAGLLSLLLLLLSAWGLVDRLSGDGINAATLYHLRADMDGAGVSDFSGYIAVFIG 80 
194367529   1 MLWILLLSFLLLCWLFLASGKWVWWKAGSLSLLLLMLSAWWLIDKLSGDGLNAATLYHLGADMEGAGVSDFKGYIAGFIV 80 
190576170   1 MLWILLLSLLLLCWLFLASGKWVWWKASAFSLLLLTLSAWWLIDKLSGDGLNAATLYHLGADMEGAGVSDFKGYIAGFIV 80 
78046002   81 MLLLSLSPLLL-VRVRRFQRPRGGGAVFAGFVGMLLVGIAASPLYRDGKRLYYQLRPVDYAT---VVPEYQVPQQPLHKR 156
161485718  81 MLLLSLSPLLL-VRIRRFQRPRGGGAVFAGFVGMLLVGIAASPLYRDGKRLYYQLRPVDYAT---VVPEYQVPQQPLHKR 156
161485703  81 MVLLSLSPLVL-LRVRRFRRPRGGGAVFGAFVVMLLVSVAVSPLYRDGKRLYYQLRPVDYAT---VVPEYQVPQQPLQKR 156
162017110  81 MVLLSLSPLVL-LRVRRFRRPRGGGAVFGAFVVMLLVSVAVSPLYRDGKRLYYQLRPVDYAT---VVPEYQVPQQPLQKR 156
146313151  78 FIFLCVIIIFAsFKCRRIIPARKPWVLNSIFIFCCVLTLTQSNAMRN---VYNSFSSASFGKgleVARNYSNINYKTDKK 154
188989830  81 MVLLSLSPLML-LRVRRFRRPRGGGAVFGAFVVMLLVSMAVSPVYRDGKRLYYQLRPVDYAT---VVPEYQVPQQPLQKR 156
194367529  81 LALVSLLPLFA-TRVKRWRRTGHGGALFAGFAAVWVATIMISPLARDGQRLYQQLRPVDFAR---IAPEYQVPTQPLQRP 156
190576170  81 LALVSLLPLFA-TRVKRWRRPRHGGALFAGFAAVWVATIMISPLARDGQRLYQQLRPVDFAR---IAPEYQVPTQPLQRP 156
78046002  157 KNIVWIYGESLERTYFDEQVFPGLMPNLRALATEAVDVRNLASTEGSGWTIAGMVASMCGVPLTTAPGDENSMDRMGMFL 236
161485718 157 KNIVWIYGESLERTYFDEQVFPGLMPNLRAVATEAVDVRNLASTEGSGWTIAGMVASMCGVPLTTAPGDENSMDRMGMFL 236
161485703 157 KNIVWIYGESLERTYFDEATFPGLMPNLHQLATEAVDVRNLTSTEGSGWTIAGMVASMCGVPLTTAPGDENSMGRMGLFL 236
162017110 157 KNIVWIYGESLERTYFDEATFPGLMPNLHQLATEAVDVRNLTSTEGSGWTIAGMVASMCGVPLTTAPGDENSMGRMGLFL 236
146313151 155 YNYVFIYAESLERSLRNIDGV-NYIPHITRLANDYFDFTNIEQIPGMGWTMAGMVNTQCAVPLVLPQG--NTANNMSHFL 231
188989830 157 KNIVWIYGESLERTYFDEATFPGLMPNLRQLATEAVDVRNLTSTEGSGWTIAGMVASMCGVPLTTAPGDENSMGRMGLFL 236
194367529 157 RNIVWIYGESLERTYLDESVFPGLMPNLNRLASESLDVRGLASAEGSGWTIAGLVSSMCGVPLTTSQGDENSMDRMGSFL 236
190576170 157 RNIVWIYGESLERTYLDENVFPGLMPNLNRLASESLDVRNLASAEGSGWTIAGLVSSMCGVPLTTSQGDENSMDRMGSFL 236
78046002  237 PEARCLGDYLKDQGYRNHYVGGADASFAGKGRFLSSHGFDVVHDVHHF-HDQGVAPKHFSAWGVHDDVLLDDAWDTFQTL 315
161485718 237 PEARCLGDYLKDQGYRNHYVGGADASFAGKGRFLSSHGFDVVHDVHYF-QDQGVAPKHFSAWGVHDDVLLDDAWDTFQTL 315
161485703 237 PEARCLGDYLKDQGYRNHYVGGADASFAGKGSFLASHGFDVVHDVNYF-HDKGVAPKHFSAWGVHDDVLLDDAWDSFQTL 315
162017110 237 PEARCLGDYLKDQGYRNHYVGGADASFAGKGSFLASHGFDVVHDVNYF-HDKGVAPKHFSAWGVHDDVLLDDAWDSFQTL 315
146313151 232 AGADCIATHLQKNGYTTEFVRGSDKEFAGGDKFFSQHGWQEQHDKNYFlTNKLLTEKDLSGWGVHDDKLIDHVYNEFERL 311
188989830 237 PEARCLGDYLKDQGYRNHYVGGADASFAGKGSFLASHGFDVVHDVNYF-HDKGVAPKHFSAWGVHDDVLLDDAWESFQTL 315
194367529 237 PKAVCLGDYLKQQGYTNHYLGGANGQFAGKGQFLASHGFDEVHDLAWFkQQKKIGRIHYSAWGVHDDVLLDTAYQRFEQL 316
190576170 237 PKAVCLGDYLKQQGYTNHYLGGANGQFAGKGQFLASHGFDEVHDLAWFkQQKKIGRIHYSAWGVHDDVLLDTAYQRFEQL 316
78046002  316 SRAGQPFMLTTLTMDTHHPAGHLPLACKGQQYDSALGDIGLLHAIKCSDRLIGELVARIRNSRYGKNTIIVIASDHLAMP 395
161485718 316 SRAGQPFLLTTLTMDTHHPAGHLPSACKGQQYDSPLGDIGLLHAIKCSDRLIGELVARIRNSRYGKNTIIVIASDHLAMP 395
161485703 316 SRAGQPFMLTTLTMDTHHPAGHLPLACKNQRYESPLGDIGLLHAIKCSDRLIGRLVTRIRNSRYGRNTIIVIASDHLAMP 395
162017110 316 SRAGQPFMLTTLTMDTHHPAGHLPLACKNQRYESPLGDIGLLHAIKCSDRLIGRLVTRIRNSRYGRNTIIVIASDHLAMP 395
146313151 312 SAKRENFLLSFLTVNTHPPAGTYLSVCDGKIPDNI--DNPMLKSVSCSDYLLGQFIDKIINSAYFDNTIIVLVSDHLMMA 389
188989830 316 SRAGQPFMLTTLTMDTHHPAGHLPLACKNQRYESPLGDIGLLHAIKCSDRLIGELVTRIRNSRYGRNTIIVIASDHLAMP 395
194367529 317 SRAGSPFMLTTLTMDTHHPAGHLPVSCKGERYQSQYGNINMLNALKCSDRLISQLVERIQASPYGKDTLIVIASDHLAMP 396
190576170 317 SRAGSPFMLTTLTMDTHHPAGHLPVSCKGERYQSQYGNINMLNALKCSDRLISQLVERIQASPYGKDTLIVIASDHLAMP 396
78046002  396 NDLSDVL--AKQKRENLLLFLGKDIAPQQVLTRAGSTLDSGATLLQLLEPGMRTLGFGRSLLARDAPPSASVAASRDSGK 473
161485718 396 NDLSDVL--AKQKRENLLLFLGEDIAPQQVVTRAGSTLDSGATLLQLLEPGMRTLGFGRSFLASDAPPSASAAASRDSGK 473
161485703 396 NDLSDVL--AKQKRENLLLFLGKDIPPQQVVTRAGSTLDSGATLLQLLEPGMRTLGFGRSLLANDAPPSASVAASRDSGK 473
162017110 396 NDLSDVL--AKQKRENLLLFLGKDIPPQQVVTRAGSTLDSGATLLQLLEPGMRTLGFGRSLLANDAPPSASVAASRDSGK 473
146313151 390 NAASDKLneTKEKRLNNFIVIKKGLKAQQI-NKAGTLLDVWPTVLAFSSAETTDFGFGHSLLSDAK---SDILDTWADSK 465
188989830 396 NDLSDVL--AKQKRENLLLFLGKDIPPQQVVRRAGSTLDSGATLLQLLEPGMRTLGFGRSLLANDAPPSASVAASRDSGR 473
194367529 397 NDLTHIL--TRQKRENLLLFLGDDIAPQQLSADAGTTLDSGATLLSLLDPNLKTMGFGRSLIDTQRAPSASVATQRDGGR 474
190576170 397 NDLTHIL--TRQKRENLLLFLGDGIAPQQLSADAGTTLDSGATLLSLLDPNLKTMGFGRSLIDTQRAPSASVATQRDGGR 474
78046002  474 DYPRYLAYARTLWTGRSTRMLRINGNGDVVVGVQQVRPPVLLEYDKDTNLKTVYLENTSRQFDRTHSKG-TLAYVDRCTA 552
161485718 474 DYPRYLAYARTLWTGRSTRMLRINGNGDVVVGVQQVRPPVLLEYDKDTNLKTVYLENTSRQFDRTHSKG-TLAYVDRCTA 552
161485703 474 NYPRYLAYARTLWTGRSTRMLRVNGNGDVVVGVQQVRPPVLLEYDDNTNLKTVYLENTSRQFDRTHSDG-TLAYVDRCTA 552
162017110 474 NYPRYLAYARTLWTGRSTRMLRVNGNGDVVVGVQQVRPPVLLEYDDNTNLKTVYLENTSRQFDRTHSDG-TLAYVDRCTA 552
146313151 466 NISNYLGFASSLWNYPSLNDPMIFKEGVFTLGQQQYQIPLFGVVDKNNNIKSIYFEAFATNAKKITEEGdSLFYINDCAM 545
188989830 474 DYPRYLAYARTLWTGRSTRMLRVNGNGDVVVGVQQVRPPVLLEYDDDTNLKTVYLENTSRQFDRTHSDG-TLAYVDRCTA 552
194367529 475 DYPQYLAFARSLWLGEPTRELKIDGDDQVVVGLQHVQPPVLLEYDKDWGLKSVYLENTSRQFDDANPDN-TLAYVDRCTA 553
190576170 475 DYPQYLAFARSLWLGEPTRELKIDGDDQVVVGLQHVQPPVLLEYDKDWGLKSVYLENTSRQFDDADPDN-TLAYVDRCTA 553
78046002  553 FEDGSADGHWCALVVDRHQSMK--------------------------------LYRDPDLTRGI-------------AV 587
161485718 553 FEDGSADGDWCALVVDRHQSMK--------------------------------LYRDPDLARGI-------------AI 587
161485703 553 FEDGSADGDWCALVVDRNQHMK--------------------------------LYRDPDLTRGI-------------AV 587
162017110 553 FEDGSADGDWCALVVDRNQHMK--------------------------------LYRDPDLTRGI-------------AV 587
146313151 546 --TSTNKKGLCGYELTRQNTTQyqitasgitdrnvldtvsplyttdfisvssgpLNQETGMTDGIqhfdmprgvtfysVR 623
188989830 553 FEDGSADGDWCALVVDRNQHMK--------------------------------LYRDPDLTRGI-------------AV 587
194367529 554 FEDGSADGDWCALLVNRDNGIK--------------------------------LYRDNDLRGGI-------------AV 588
190576170 554 FEDGSADGDWCALLVNRDNGIK--------------------------------LYRDNDLRGGI-------------AV 588
78046002  588 DAPLEATQQGPRPRVRQPIMLTQAARKTDAGRYMLELYAKRRPTRAFWVEAVSSERKVVLA---------QQWVVPDAAG 658
161485718 588 DAPLEATQQGPRPRVRQPIMLTQAARKTDAGRYMLELYAKRRPTRAFWVEAVSSERKVVLA---------QQWVVPDAAG 658
161485703 588 DAPLDVTPQAPRPRVRQPIMLTQAARKTEAGRYMLELYAKRRPTRAFWVEAVSSERKVVLA---------QQWVVPDASG 658
162017110 588 DAPLDVTPQAPRPRVRQPIMLTQAARKTEAGRYMLELYAKRRPTRAFWVEAVSSERKVVLA---------QQWVVPDASG 658
146313151 624 DGHLETNQKISFDTCNNQQISIETVNQHLNDDITRLIFTSNDSAFCIPYEVRPSINNVLRSdaasllaprQQFIGVYDKN 703
188989830 588 DAPLDVTPQAPRPRVRQPIMLTQAARKTEAGRYMLELYAKRRPTRAFWVEAVSSERKVVLA---------QQWVVPDASG 658
194367529 589 DAPLDAF-QGPRPSVRQAHMITQKGRRTRAGQYMLQLVASTRPDRGFWIEAVSSQRKVVLA---------QQWVQPDANG 658
190576170 589 DAPLDAF-QGPRPSVRQAHMITQKGRRTRAGQYMLQLVASTRPDRGFWIEAVSSQRKVVLA---------QQWVQPDANG 658
78046002  659 RIRMPVGLEHAVEDLEIRAWLDYTEDVSVDDLALVKDIPVADRS 702
161485718 659 RIRMPVGLEHAVEDLEIRAWLDYTEDVSVDDLALVKDIPVADRS 702
161485703 659 RIRMPVGLEHAVEDLEIRAWLDYTEEVSVDDLALVKDTAVADRS 702
162017110 659 RIRMPVGLEHAVEDLEIRAWLDYTEEVSVDDLALVKDTAVADRS 702
146313151 704 QTKFVIGVPEKPLDVFI----------SKDDFKLYQLCNIFSEC 737
188989830 659 RIRMPVGLEHAVEDLGIRAWLDYTEEVSVDDLALVKDTAVADRS 702
194367529 659 KINVSFGLDHEVDDLEIRAWLNHAEKLAVDTFALVPSRSRPRG- 701
190576170 659 KINVSFGLDHEVDDLEIRAWLNHAEKLAVDTFALVPSRGRPRG- 701
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap