Conserved Protein Domain Family
PRK12339

?
PRK12339: PRK12339 
mevalonate-3-phosphate 5-kinase
Statistics
?
PSSM-Id: 105560
View PSSM: PRK12339
Aligned: 4 rows
Threshold Bit Score: 297.086
Threshold Setting Gi: 86741079
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
86741079   4 PETTIHIVYGIPCVGKSTGAVAFAHHRAIRTVVQTDYLREVQRAYVDLErvPVLAKVTHTAWELYGSPTQHNIVTGFADH 83 
16081833   1 MNSRIMFIGGVPGVGKTSISGYIARNTDIDIVLSSDYLREFLRPFAPQE--SHLETSVYDAWKFYGDMSDDNIIRGYLDQ 78 
13541683   1 MHSKIILIGGVPGVGKTSISGFLARELGIDIMLSGDYLREFLRPLFGDN--PLIQKSVYDAWQAYGQKTDENIVKGYIDQ 78 
48477551   1 ---MIVFIGGIPGVGKTSLSAYIARKKNIDIVLSGDYLREFLRSYLNDE---IMNVSVYDAWRFFGPMSNENVIKGYLYQ 74 
86741079  84 AAAIAPAIGQVVRKLVLDGFDAVVEGAHFHSPIIaalrDENRTAHIRATLLIVRTAEELRKRVAQKGRDRADGNPLKEWQ 163
16081833  79 ARPIMGGINRVIARALANGEDLIIESLYFVPDMM----DEMVLKNAFLAYVYIDDPDLHRSRLEDRINYTHRNSPGSRLA 154
13541683  79 AKIMMAGIDRILIRAIENGENLILETLYFLPEML----SEKARNNVHMFYLYIGDEKLHRDRLVDRINYTHKNSPGTRLA 154
48477551  75 ARLMYNGYNKIISRALRNGESMVIESLYFDPGLF----DNDLFNKIKVFYIYISDIEIHRSRLLSRTMYTHKNDPGERLA 150
86741079 164 DNIPFMLTIQDYLIADARGKDIEVSTADEWRRSWNPTDVPSST 206
16081833 155 AHLKEYRTIMDYSMDMARGRGIGLYSTDDYALARQRLLDDFRK 197
13541683 155 EHLYEYRNIMEYSMMRSSEYNVKIIDTSNYEEARRTILEMIVK 197
48477551 151 EQLPVYKIMEDYSIKKCGDYNVKKIDNINFDETMELLGDLIE- 192
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap