Conserved Protein Domain Family
PRK12320

?
PRK12320: PRK12320 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 138873
View PSSM: PRK12320
Aligned: 12 rows
Threshold Bit Score: 1184.4
Threshold Setting Gi: 41407676
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
31793058    1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80 
118462986   1 MHILVTDATGALGRLVAGQLIAAGHTVTGIAELPHPCLDGNVEFVCAPLRDRVLRELTDEADAVIHLAPIDPTAPGNAAM 80 
41407676    1 MHILVTDATGALGRLVAGQLIAAGHTVTGIAELPHPCLDRNVEFVCAPLRDRVLRELTDEADAVIHLAPIDPTAPGNAAM 80 
15841337    1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80 
15609005    1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80 
148823079   1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80 
148661674   1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80 
253799088   1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80 
183982753   4 VHVLVTDAAGAIGRLVTRQLIAAGHTVSGISSHPHDYLDPNVDFVCASLRNPVLLELASEADAVIHLAPVEKGAPGAAGI 83 
118618399   1 MHVLVTDAAGAIGRLVTRQLIAAGHTVSGISSHPHDYLDPNVDFVCASLRNPVLLELASEADAVIHLAPVEKGAPGAAGI 80 
121637771   1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80 
224990255   1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80 
31793058   81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
118462986  81 DGLARVTDAAARAGSRLLFVSQAAGRPELYRPAEDLVASSWGPSVVVRIAPPVGRQLDWMVCRTVATVLRTKVSAQPMRV 160
41407676   81 DGLARVTDAAARAGSRLLFVSQAAGRPELYRPAEDLVASSWGPSVVVRIAPPVGRQLDWMVCRTVATVLRTKVSAQPMRV 160
15841337   81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
15609005   81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
148823079  81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
148661674  81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
253799088  81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
183982753  84 TGLAHVSNAAARAGARLLFVSQAAGSPELYQQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLMRSKVSARPMRV 163
118618399  81 TGLAHVSNAAARAGARLLFVSQAAGSPELYQQAETLVSTGWAPSSVIRIAPPVGRQLDWTVCRTVTTLMRSKVSARPMRV 160
121637771  81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
224990255  81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
31793058  161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
118462986 161 LHLDDLMRFLVTALDTDRTGVVDLASPDTVNLVTAWRMLRATDPRSRLHRVRSWSQLIPDLNVAAAQEDWLFEFGWHALD 240
41407676  161 LHLDDLMRFLVTALDTDRTGVVDLASPDTVNLVTAWRMLRATDPRSRLHRVRSWSQLIPDLNVAAAQEDWLFEFGWHALD 240
15841337  161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
15609005  161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
148823079 161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
148661674 161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
253799088 161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
183982753 164 LHLDDLVRFLVLALDTDRNGVVDLATPDTTNVVTAWRLLGSVDPRLRPHRVQGWSQLIPEMDIAAAQEDWNFQYGWQATD 243
118618399 161 LHLDDLVRFLVLALDTDRNGVVDLATPDTTNVVTAWRLLGSIDPRLRPHRVQGWSQLIPEMDIAAAQEDWNFQYGWQATD 240
121637771 161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
224990255 161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
31793058  241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
118462986 241 AVADTARGLVGRRLDTAGAINHGAQLALPVEVLPQRA---GNGAHSAAPEGVEGEFDDRIDPRFPVFSATALTDALPGPL 317
41407676  241 AVADTARGLVGRRLDTAGAINHGAQLALPVEVLPQRA---GNGAHSAAPEGVEGEFDDRIDPRFPVFSATALTEALPGPL 317
15841337  241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
15609005  241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
148823079 241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
148661674 241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
253799088 241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
183982753 244 AIVDTGRGLVGRRLDPAGATIGSAQLALPVEPTPRLTpadGTALDSAAPDGLEGEFDDRIDPRFPVFSAASLAEALPGPL 323
118618399 241 AIVDTGRGLVGRRLDPAGATIGSAQLALPVEPTPRLTpadGTALDSAAPDGLEGEFDDRIDPRFPVFSAASLAEALPGPL 320
121637771 241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
224990255 241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
31793058  321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
118462986 318 TPITLDVQLSGLRTASRVLGRVLALGGAVGEEWDSRAIAVFGHRPYVGVSVNMVAATQLPGWDQDAVARDALVGRPQVGD 397
41407676  318 TPITLDVQLSGLRTASRVLGRVLALGGAVGEEWDSRAIAVFGHRPYVGVSVNMVAATQLPGWDQDAVARDALVGRPQVGD 397
15841337  321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
15609005  321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
148823079 321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
148661674 321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
253799088 321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
183982753 324 TPMTLDVQMSGLRAAGRAMGQVLALGDVVAEEWGSRAIAVFGHRPYVGVSANLVAATQLPGWNERAVTQQALGGNTQVTE 403
118618399 321 TPMTLDVQMSGLRAAGRAMGQVLALGDVVAEEWGSRAIAVFGHRPYVGVSANLVAATQLPGWNERAVTQQALGGNTQVTG 400
121637771 321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
224990255 321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
31793058  401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
118462986 398 PLPFGEPALAGGALGSIAKAVAAGRSVALLRHLRANTRDYCAAAVAEQVDAAQLALLPQAALEVRLRLLRDRIHQGWILN 477
41407676  398 PLPFGEPALAGGALGSIAKAVAAGRSVALLRHLRANTRDYCAAAVAEQVDAAQLALLPQAALEVRLRLLRDRIHQGWILN 477
15841337  401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
15609005  401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
148823079 401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
148661674 401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
253799088 401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
183982753 404 LLPFGRPQLTGGPLRSAAKVLVTARSLSLLRHIRADTQAYVTAAADEHVGAEQLSTLPDASLEVRIRLLRDRIHQGWILT 483
118618399 401 LLPFGRPQLTGGPLRSAAKVLVTARSLSLLRHIRADTQAYVTAAADEHVGAEQLSTLPDASLEVRIRLLRDRIHQGWILT 480
121637771 401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
224990255 401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
31793058  481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
118462986 478 ALWLLDTGITAAALVRSQAGQSVPGLGMITESGLVAAETAELAAMLAADPPLCALAADGNLASIRALAPKTAAAVDAAVA 557
41407676  478 ALWLLDTGITAATLVRSQAGQSVPGLGMITESGLVAAETAELAAMLAADPPLCALAADGNLASIRALAPKTAAAVDAAVA 557
15841337  481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
15609005  481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
148823079 481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
148661674 481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
253799088 481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
183982753 484 ALWVIDTGVTAATLEHTRAGTSVSGVGVIMESGRIAAEIAALTEILRADAPLCALARDGNVDSIRALSASAAAALDATVA 563
118618399 481 ALWVIDTGVTAATLEHTRAGTSVSGVGVIMESGRIAAETAALTEILRADAPLCALARDGNVDSIRALSASAAAALDATVA 560
121637771 481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
224990255 481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
31793058  561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHDTTIRFTHELRMTLRELGSR 640
118462986 558 RIGHRGPGDAELASQTFADDPAMLLSAAAAAAAAPAEPAAPATLAERLAANARGSKELAHDATMRFTHELRMTLRALGSL 637
41407676  558 RIGHRGPGDAELASQTFGDDPAMLLSAAA--AAAPAEPAAPATLAERLAANARGSKELAHDATMRFTHELRMTLRALGSL 635
15841337  561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHDTTIRFTHELRMTLRELGSR 640
15609005  561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHDTTIRFTHELRMTLRELGSR 640
148823079 561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHDTTIRFTHELRMTLRELGSR 640
148661674 561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHDTTIRFTHELRMTLRELGSR 640
253799088 561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHDTTIRFTHELRMTLRELGSR 640
183982753 564 RLAHRGCGEAELANPSFGDDPALLLTAAAKAAAAPATPAAAPTLSQRLAASARGSRELAHDTTIRFTHDLRMTLRELASR 643
118618399 561 RLAHRGCGEAELANPSFGDDPALLLTAAAKAAAAPATPAAAPTLSQRLAASARGSRELAHDTTIRFTHDLRMTLRELASR 640
121637771 561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHGTTIRFTHELRMTLRELGSR 640
224990255 561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHGTTIRFTHELRMTLRELGSR 640
31793058  641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
118462986 638 RVEADLIDAVDDVYYLTCNELVTMPGDARLRIKRRRTERERLQVQCPPEVIDGRWTPPQ 696
41407676  636 RVEADLIDAVDDVYYLTCNELVTMPGDARLRIKRRRTERERLQVQCPPEVIDGRWTPPQ 694
15841337  641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
15609005  641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
148823079 641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
148661674 641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
253799088 641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
183982753 644 RVTADLMDTIDDVYYLTADELVTMPADARLRIKRRRTERERLQAQHPPEVIDGNWNPAL 702
118618399 641 RVTADLMDTIDDVYYLTADELVTMPADARLRIKRRRTERERLQAQHPPEVIDGNWNPAL 699
121637771 641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
224990255 641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap