Conserved Protein Domain Family
PRK12279

?
PRK12279: PRK12279 
50S ribosomal protein L22/unknown domain fusion protein; Provisional
Statistics
?
PSSM-Id: 138835
View PSSM: PRK12279
Aligned: 3 rows
Threshold Bit Score: 492.283
Threshold Setting Gi: 26554460
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
170762229   1 MTNKVIQRNIHISHRKASLVIDLVRNKPVHEAIRILSNTPKKFAPIVLKLLNSAISNVQhNSKDMDPSKLYIYKIVANQG 80 
26554460    1 MQARAIQKNIHVSPRKAKLVCDLIRNKPVTNALSILENTNKKTAVFLKKLLHQAIANAT-NNHAMQADKLYVYHVVANQG 79 
209554129   1 MTNKVIQRNIHISHRKASLVIDLVRNKPVHEAIRILSNTPKKFAPIVLKLLNSAISNVQhNSKDMDPSKLYIYKIVANQG 80 
170762229  81 PTMKRTLPRAKGSADQLFKRTTHLEIVLSDDVNEREKELAAIKAK---------------------------KSKKPLAV 133
26554460   80 STLKRTSPRAKGSADLIRKRHTHLEIVLSDDVNERNKEIQAIKDRikkraannkgywakqraaneaglkvveKPKKAKPA 159
209554129  81 PTMKRTLPRAKGSADQLFKRTTHLEIVLSDDVNEREKELAAIKAK---------------------------KSKKPLVV 133
170762229 134 EPIAKVETKKVAKPSKVEIKPvEKDENVDPELLKREQQVLKVVE----KTASQKEEETTETIMISTSPKNAQVLF-DDLE 208
26554460  160 QPKKPVEKKPQPKPEPKVVKE-EPVKPVKAESLKREQEVLKVVEtkpvEGAKKAKVEETAIIMISTKKEYADNLLnEELN 238
209554129 134 EPVAKVETKKVAKPSKVETKPvEKDENVDPELLKREQQVLKVVE----KTASQKEEETTETIMISTSPKNAQVLF-DDLE 208
170762229 209 KNVIFYKTTPINKVLRVLVYVTSPTKKVVGEFDLESVEIGAISSIWRKYSKQSVISKKEYDAYYEGKDKAHALVSKKAYK 288
26554460  239 KNVFFYKVTPVNPIKRVLIYTTTGKKGVVGEFDLDKIEILALSTAWKKYGQQSCMSKKDFDEYYKDSEKAHILISKEAFR 318
209554129 209 KNVIFYKTTPVNKVLRVLVYVTSPTKKVVGEFDLESVEIGAISSIWRKYNKQSVISKKEYDAYYEGKDKAHALVSKKAYK 288
170762229 289 YRNPKDLSEYNMTKGPSGFQYLK 311
26554460  319 YSRPKTLESYNMKKGPSGFQYLK 341
209554129 289 YRNPKDLSEYNMTKGPSGFQYLK 311
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap