Conserved Protein Domain Family
PRK12269

?
PRK12269: PRK12269 
bifunctional cytidylate kinase/ribosomal protein S1; Provisional
Statistics
?
PSSM-Id: 105491
View PSSM: PRK12269
Aligned: 2 rows
Threshold Bit Score: 1820.09
Threshold Setting Gi: 15639271
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15639271    1 MHGGGERERSFVHPRTRCVAVRARTVLQCRPMGTVIIALDGPAGSGKSSVCRLLASRLGAQCLNTGSFYRAFTLAALRRV 80 
189025513   1 MHGGGERERSFVHPRTRCVAVRARTVLQCRPMGTVIIALDGPAGSGKSSVCRLLASRLGAQCLNTGSFYRAFTLAALRRV 80 
15639271   81 SELAVQACSPSPDPDAAVGCAAVPHATNLDTSYAPLTAQKKVALFDEAYWVSFARTVALSYRAGVMYVGEENVESLLRSD 160
189025513  81 SELAVQACSPSPDPDAAVGCAAVPHATNLDTSYAPLTAQKKVALFDEAYWVSFARTVALSYRAGVMYVGEENVESLLRSD 160
15639271  161 EVESAVSYFAAMPAIRAIMTGKIRSAVCGARVVCEGRDLTTVVFVDADLKCYLDASIEARVARRWAQGTSRLSKQELEQR 240
189025513 161 EVESAVSYFAAMPAIRAIMTGKIRSAVCGARVVCEGRDLTTVVFVDADLKCYLDASIEARVARRWAQGTSRLSKQELEQR 240
15639271  241 MRARDAHDRARTVGGLRCAPDALYVDTSCLTIEEVCERIAREAHRRALWGGERSVENQEGKGTPLVPRQLQERYSFEAPE 320
189025513 241 MRARDAHDRARTVGGLRCAPDALYVDTSCLTIEEVCERIAREAHRRALWGGERSVENQEGKGTPLVPRQLQERYSFEAPE 320
15639271  321 PGSVRMGTVVQVNAGTVFVDIGGKSEGRVPVEEFEAPPKAGDGVRVYVERVTPYGPELSKTKADRLGLKVKLRDAERDGT 400
189025513 321 PGSVRMGTVVQVNAGTVFVDIGGKSEGRVPVEEFEAPPKAGDGVRVYVERVTPYGPELSKTKADRLGLKVKLRDAERDGT 400
15639271  401 PVEGRIVRLTEKKSGFEVDLGAGMMAFLPISQSDCQKVDAPESLIGLTSKFYIERISQSKQHRGNDNIVINRRRYLEERA 480
189025513 401 PVEGRIVRLTEKKSGFEVDLGAGMMAFLPISQSDCQKVDAPESLIGLTSKFYIERISQSKQHRGNDNIVINRRRYLEERA 480
15639271  481 RQAREEFFNSVHIEDSVSGVVKSFTSFGAFIDLGGFDGLLHVNDMSWGHVARPREFVKKGQTIELKVIRLDQAEKRINLS 560
189025513 481 RQAREEFFNSVHIEDSVSGVVKSFTSFGAFIDLGGFDGLLHVNDMSWGHVARPREFVKKGQTIELKVIRLDQAEKRINLS 560
15639271  561 LKHFQPDPWLEFENKFGVNDVVKGRVTKIADFGAFIELAEGIEGLAHISEFSWVKKTSKPSDMVKIGDEVECMILGYDIQ 640
189025513 561 LKHFQPDPWLEFENKFGVNDVVKGRVTKIADFGAFIELAEGIEGLAHISEFSWVKKTSKPSDMVKIGDEVECMILGYDIQ 640
15639271  641 AGRVSLGLKQVTANPWEEIEARYPVGARFTRRIVKVTNAGAFIEMEEGIDGFLHVDDLSWVKRTRPADHELEVGKEIECM 720
189025513 641 AGRVSLGLKQVTANPWEEIEARYPVGARFTRRIVKVTNAGAFIEMEEGIDGFLHVDDLSWVKRTRPADHELEVGKEIECM 720
15639271  721 VIECDPQARRIRLGVKQLSDNPWQVFANAYGVGSTVEGEVSSVTDFGIFVRVPGGVEGLVRKQHLVENRDGDPGEALRKY 800
189025513 721 VIECDPQARRIRLGVKQLSDNPWQVFANAYGVGSTVEGEVSSVTDFGIFVRVPGGVEGLVRKQHLVENRDGDPGEALRKY 800
15639271  801 AVGDRVKAVIVDMNVKDRKVAFSVRDYQRKVQRDELSRYMSAPRGEDEGSFTLGDLMRQTSGK 863
189025513 801 AVGDRVKAVIVDMNVKDRKVAFSVRDYQRKVQRDELSRYMSAPRGEDEGSFTLGDLMRQTSGK 863
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap