Conserved Protein Domain Family
algU

?
PRK11923: algU 
RNA polymerase sigma factor AlgU; Provisional
Statistics
?
PSSM-Id: 171347
View PSSM: PRK11923
Aligned: 22 rows
Threshold Bit Score: 356.034
Threshold Setting Gi: 91794123
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
28871366    1 MLTQEEDQALVERVQRGDTRAFDLLVLKYQHKILGLIVRFVHDTHEAQDVAQEAFIKAYRALGNFRGDSAFYTWLYRIAI 80 
15595959    1 MLTQEQDQQLVERVQRGDKRAFDLLVLKYQHKILGLIVRFVHDAQEAQDVAQEAFIKAYRALGNFRGDSAFYTWLYRIAI 80 
90021896    4 QTAQDSDHQLVLRVQKGDKRAFDMLVIKYQHKILSIISRYIKDNAEIHDVAQEAFIKAYRAIGNFRGDSAFYTWIYRIAI 83 
92113750    1 MGTRETDHQLVERAQKGDTRAFDLLVKKYQHKIIGLIGRYVHDPAEVQDVAQEAFIKAYRALGKFRSESAFYTWMYRIAI 80 
116048678   1 MLTQEQDQQLVERVQRGDKRAFDLLVLKYQHKILGLIVRFVHDAQEAQDVAQEAFIKAYRALGNFRGDSAFYTWLYRIAI 80 
146306499   1 MLTQEDDQQLVERVQRGDKRAFDLLVLKYQHKILGLIVRFVHDTHEAQDVAQEAFVKAYRALGNFRGDSAFYTWLYRIAI 80 
146281607   1 MLTQEQDQQLVERVQRGDKRAFDLLVMKYQHKILGLIVRFVHDSHEAQDVAQEAFIKAYRALANFRGDSAFYTWLYRIAI 80 
152984416   1 MLTQEQDQQLVERVQRGDKRAFDLLVLKYQHKILGLIVRFVHDAQEAQDVAQEAFIKAYRALGNFRGDSAFYTWLYRIAI 80 
192360459   4 PLAPDMDQQLVERVQKGDKRAFDLLVIKYQHKVLAVISRLVRDHAEAQDVAQEAFIKAYRALPNFRGDSAFYTWIYRIAI 83 
218893295   1 MLTQEQDQQLVERVQRGDKRAFDLLVLKYQHKILGLIVRFVHDAQEAQDVAQEAFIKAYRALGNFRGDSAFYTWLYRIAI 80 
28871366   81 NTAKNYLVSRGRRPPDSDVRSEDAEFYDGDHGLKDIESPERALLRDEIEGTVHRTIQLLPEDLRTALTLREFDGLSYEDI 160
15595959   81 NTAKNHLVARGRRPPDSDVTAEDAEFFEGDHALKDIESPERAMLRDEIEATVHQTIQQLPEDLRTALTLREFEGLSYEDI 160
90021896   84 NTAKNYLVSRGRRPPSSDVDVEDAEFYSGSDSLKDVDTPENHAMRDQLETVVNNAIKALPEDLRTAVTLREMEGLSYEEI 163
92113750   81 NTAKNHLVSRGRRPPGSDMDIVDAEVLDHSGRLSDIDTPEAALQRDQLEAVVFEVIENLPEDLRTAITLREMDGLAYEDI 160
116048678  81 NTAKNHLVARGRRPPDSDVTAEDAEFFEGDHALKDIESPERAMLRDEIEATVHQTIQQLPEDLRTALTLREFEGLSYEDI 160
146306499  81 NTAKNYLVSRGRRPPDSDVSSDDAEFYDGDHALKDIESPERALLRDEIEATVHRTIAQLPDDLRTALTLREFEGLSYEDI 160
146281607  81 NTAKNHLVARGRRPPDSDVSSEDAEFYEGDHALKDIESPERSLLRDEIEDTVHRTIQLLPEDLRTALTLREFDGLSYEDI 160
152984416  81 NTAKNHLVARGRRPPDSDVTAEDAEFFEGDHALKDIESPERAMLRDEIEATVHQTIQQLPEDLRTALTLREFEGLSYEDI 160
192360459  84 NTAKNHLVARNRRPPSSDLEVDEAEFYPGNDAIHEMNTPERSLLRDELQATIEQAFQDLPPDLRTAVSLRELEGLSYEEI 163
218893295  81 NTAKNHLVARGRRPPDSDVTAEDAEFFEGDHALKDIESPERAMLRDEIEATVHQTIQQLPEDLRTALTLREFEGLSYEDI 160
28871366  161 ASVMQCPVGTVRSRIFRAREAIDKALQPLLQES 193
15595959  161 ATVMQCPVGTVRSRIFRAREAIDKALQPLLREA 193
90021896  164 AEVMSCPVGTVRSRIFRAREAIDKEIAPLL--- 193
92113750  161 ANIMQCPVGTVRSRIFRAREAVDKAIAPLLSTS 193
116048678 161 ATVMQCPVGTVRSRIFRAREAIDKALQPLLREA 193
146306499 161 ASVMQCPVGTVRSRIFRAREAIDKSLQPLLQEA 193
146281607 161 ASVMQCPVGTVRSRIFRAREAIDKALQPLLHES 193
152984416 161 ATVMQCPVGTVRSRIFRAREAIDKALQPLLREA 193
192360459 164 AEVMECPVGTVRSRIFRAREAIDRRIKPLVEDL 196
218893295 161 ATVMQCPVGTVRSRIFRAREAIDKALQPLLREA 193
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap