Conserved Protein Domain Family
rirA

?
PRK11920: rirA 
iron-responsive transcriptional regulator RirA
Statistics
?
PSSM-Id: 171344
View PSSM: PRK11920
Aligned: 29 rows
Threshold Bit Score: 261.251
Threshold Setting Gi: 254780620
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
86356384    1 MRLTKQTNYAVRMLMYCAANEGQLSRIPEIAKAYGVSELFLFKILQPLNKAGLVETVRGRNGGVRLGKPAADITLFDVVR 80 
110633798   1 MRLTRQTNYAIRILMYCAANEGRLSRIPDIAQAYSLSDLFLFKILQPLVEAGFVQTVRGRNGGVKLGKPAEDITLFDVIR 80 
150395554   1 MRLTKQTNYAVRMLMYCAANGQKLSRIPEIARAYGVSELFLFKILQPLTRAGLVETVRGRNGGVRLPRPAAEITLFDVVK 80 
15964483    1 MRLTKQTNYAVRMLMYCAANGEKLSRIPEIARAYGVSELFLFKILQPLTRAGLVETVRGRNGGVRLPRPASEITLFDVVK 80 
49475376    1 MRLTKQTNYALRILMYCADNQESLSRIPEIAKAYAVSELFLFKILQPLVEAGFVKTVRGRNGGVKLAKPAAEISVADVVK 80 
49474135    1 MRLTKQTNYALRMLMYCADNQGSLSRIPDIAKAYAISEFFLFKILQPLVEAGFIQTVRGRNGGIKLAKPAAEISVADVVK 80 
163868066   1 MRLTKQTNYALRMLMYCADNQGSLSRVSEIAKAYAVSELFLFKILQPLVQAGFIQTVRGRNGGVKLAKPATEISVADVLK 80 
222147641   1 MRLTKQTNYAVRILMYCAANKDHLSRIPEIAKAYGVSELFLFKILQPLNKAGLVETVRGRNGGVRLGRAPEKISLFDVVK 80 
227820925   1 MRLTKQTNYAVRMLMYCAANGEKLSRIPEIAKAYGVSELFLFKILQPLTRAGLVETVRGRNGGVRLPKPASEISLFDVVK 80 
240850269   1 MRLTKQTNYALRMLMYCADNQGTLSRVPEIAKAYAVSELFLFKILQLLVQAGFIQTVRGRNGGVRLAKPAAEISVADVVK 80 
86356384   81 VTEDSFAMAECFEdDGMVECPLVDSCGLNSALRKALNAFFAVLSEYTIDDLVKARPQINFLLGLTgeqAYRKPAIVA 157
110633798  81 VTEESFAMAECFE--NDTECPLVDGCGLNEALRKALGAFFEVLASYTIQDLVDARPNMRDVLGLE---VQQVPLATT 152
150395554  81 VTEDSFAMAECFE-AGEIDCPLVDSCGLNAALRKALNAFFEVLQGYTIDDLVKARPQINFLLGLE---EPTRPQTSA 153
15964483   81 VTEDSFAMAECFE-AGEIDCPLVDSCGLNAALRKALNAFFEVLQGYTIDDLVKARPQINFLLGLE---EPVRPQTSA 153
49475376   81 VTEDNFSMAECFD-NAKSNCPLIDFCSLNTALQKALNAFFDVLSVISLADL--QRPSFRNQLKIDnreIINSNHVKG 154
49474135   81 VTEDNFSMAECFN-TAKSNCPLIDFCGLNTALQKALNAFFDVLSMISLADL--QRRSFRNQLKIDnheTIN------ 148
163868066  81 VTEDNFSLAECFD-NAEPTCPLIDFCSLNIALQKALSAFFDVLSVISLADL--QRPSFHNHFKVNkq---------- 144
222147641  81 VTEDSFAMAECFEdDGEVDCPLIDSCGLNSALRKALNAFFAVLAEYSIDDLVKARPQINFLLGIE-----DLPRLAA 152
227820925  81 VTEDSFAMAECFE-AGEIDCPLVDSCGLNAALRKALNAFFDVLKGYTIDDLVKARPQINFLLGLE---TGPRPQTSA 153
240850269  81 VTEDNFSLAECFD-TAEPTCPLIDFCSLNTALQKALNAFFEVLSVISLADL--QQPSFQNHFKIN-------DKKAN 147
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap