Conserved Protein Domain Family
flgD

?
PRK11911: flgD 
flagellar basal body rod modification protein; Provisional
Statistics
?
PSSM-Id: 138812
View PSSM: PRK11911
Aligned: 9 rows
Threshold Bit Score: 213.546
Threshold Setting Gi: 289433974
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16802738    1 MDGISSLSGASQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80 
46906947    1 MDGISSLSGAGQDTNNVVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80 
16799779    1 MDGISSLSGASQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80 
116872085   1 MDGISSLSGASQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80 
217965206   1 MDGISSLSGAGQDTNNVVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80 
226223327   1 MDGISSLSGAGQDTNNVVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80 
284801026   1 MDGISSLSGASQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80 
284994168   1 MDGISSLSGASQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80 
289433974   1 MDGISSLSGATQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80 
16802738   81 QNSALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN 140
46906947   81 QNSALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN 140
16799779   81 QNSALQSAVNFIGKDIKGVSLNGEVISGQVESVQQTTNGVMLKIKDQDSLVPMTYVTEIN 140
116872085  81 QNSALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN 140
217965206  81 QNSALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN 140
226223327  81 QNSALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN 140
284801026  81 QNSALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN 140
284994168  81 QNSALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN 140
289433974  81 QNSALQSAVNFIGKDIKGVSLNGEVISGQVESVQQTTNGVMLKLKEQDSLVPLTYVTEIN 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap