Conserved Protein Domain Family
PRK11449

?
PRK11449: PRK11449 
metal-dependent hydrolase
Statistics
?
PSSM-Id: 171118
View PSSM: PRK11449
Aligned: 49 rows
Threshold Bit Score: 503.342
Threshold Setting Gi: 205355283
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157147613   1 MSCRFIDTHCHFDFPPFTGDEAASIQRAADAGVGKIIVPATAAACFSRVLALAERFPSLFAALGLHPVFIEQHADDSLDR 80 
56416338    1 MSWRFIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATEAAHFPRVLALAARFPSLYAALGLHPIVIERHVDDDPDK 80 
197365260   1 MSWRFIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATEAAHFPRVLALAARFPSLYAALGLHPIVIERHVDDDPDK 80 
29144837    1 MSWRFIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATEAAHFPRVLALAARFPSLYAALGLHPIVIERHADDDPDK 80 
16763359    1 MSWRFIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATEAAHFPRVLALAARFPSLYAALGLHPIVIERHADDDPDK 80 
16767805    1 MSWRFIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATEAAHFPRVLALAARFPSLYAALGLHPIVIERHADDDSDK 80 
194446554   1 MSWRFIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATEAAHFPRVLALAARFPSLYAALGLHPIVIERHADDDPDK 80 
207859689   1 MSWRFIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATEAAHFPRVLALAARFPSLYAALGLYPIVIERHADDDPDK 80 
205355283   1 MSWRFIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATEAAHFPRVLALAARFPSLYAALGLHPIVIERHADDDPDK 80 
194448325   1 MSWRFIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATEAAHFPRVLALAARFPSLYAALGLHPIVIERHADDDPDK 80 
157147613  81 LQQALDQRPqKVVAVGEIGLDLYRDNPQFDEQERLLEAQLKLAKRYDLPVILHSRRTHDKLAMHLKRHALARTGVVHGFS 160
56416338   81 LQQALAQQQ-NVVAVGEIGLDLYRDDPQFARQERLLDAQLQLAKRYDLPVILHSRRTHDKLAMRLKRQDLPRTGVVHGFA 159
197365260  81 LQQALAQQQ-NVVAVGEIGLDLYRDDPQFARQERLLDAQLQLAKRYDLPVILHSRRTHDKLAMRLKRQDLPRTGVVHGFA 159
29144837   81 LQQALAQQQ-NVVAVGEIGLDLYRDDPQFARQERFLDAQLQLAKRYDLPVILHSRRTHDKLAMRLKRQSLPQTGVVHGFS 159
16763359   81 LQQALAQQQ-NVVAVGEIGLDLYRDDPQFARQERFLDAQLQLAKRYDLPVILHSRRTHDKLAMRLKRQSLPQTGVVHGFS 159
16767805   81 LQQALAQQQ-NVVAVGEIGLDLYRDDPQFARQERFLDAQLQLAKRYDLPVILHSRRTHDKLAMHLKRQDLPRTGVVHGFA 159
194446554  81 LQQALAQQQ-NVVAVGEIGLDLYRDDPQFARQERFLDAQLQLAKRYDLPVILHSRRTHDKLAMHLKRQDLPRTGVVHGFA 159
207859689  81 LQQALAQQQ-NVVAVGEIGLDLYRDDPQFARQERFLDVQLQLAKRYDLPVILHSRRTHDKLAMHLKRQDLPRTGVVHGFA 159
205355283  81 LQQALAQQQ-NVVAVGEIGLDLYRDDPQFARQERFLDAQLQLAKRYDLPVILHSRRTHDKLAMHLKRQDLPRTGVVHGFA 159
194448325  81 LQQALAQQQ-NVVAVGEIGLDLYRDDPQFARQERFLDAQLQLAKRYDLPVILHSRRTHDKLAMRLKRQELPRTGVVHGFA 159
157147613 161 GSLQQAERFVQLGYKIGVGGTITYPRASKTRDVMAQLPLDALLLETDAPDMPLNGFQGQPNRPEQAARVFSKLCALRDEP 240
56416338  160 GSLQQAERFVQLGYKIGVGGTITYPRASKTRDVMARLPLDALLLETDAPDMPLKGFQGQPNRPEQAARVFDALCELRPEP 239
197365260 160 GSLQQAERFVQLGYKIGVGGTITYPRASKTRDVMARLPLDALLLETDAPDMPLKGFQGQPNRPEQAARVFDALCELRPEP 239
29144837  160 GSLQQAERFVQLGYKIGVGGTITYPRASKTRDVMARLPLDALLLETDAPDMPLKGFQGQPNRPEQAARVFDALCELRPEP 239
16763359  160 GSLQQAERFVQLGYKIGVGGTITYPRASKTRDVMARLPLDALLLETDAPDMPLKGFQGQPNRPEQAARVFDALCELRPEP 239
16767805  160 GSLQQAERFVRLGYKIGVGGTITYPRASKTRDVMARLPLDALLLETDAPDMPLKGFQGQPNRPEQAARVFDALCELRPEP 239
194446554 160 GSLQQAERFVQLGYKIGVGGTITYPRASKTRDVMARLPLDALLLETDAPDMPLKGFQGQPNRPEQAARVFDALCELRPEP 239
207859689 160 GSLQQAERFVRLGYKIGVGGTITYPRASKTRDVMARLPLDALLLETDAPDMPLKGFQGQPNRPEQAARVFDALCELRPEP 239
205355283 160 GSLQQAERFVRLGYKIGVGGTITYPRASKTRDVMARLALDALLLETDAPDMPLKGFQGQPNRPEQAARVFDALCELRPEP 239
194448325 160 GSLQQAERFVRLGYKIGVGGTITYPRASKTRDVMARLPLDALLLETDAPDMPLKGFQGQPNRPEQAARVFDALCELRPEP 239
157147613 241 SEVIAETLYRNTTALFRL 258
56416338  240 AEVIADALYRNTITLFRL 257
197365260 240 AEVIADALYRNTITLFRL 257
29144837  240 AEVIADTLYRNTVTLFRL 257
16763359  240 AEVIADTLYRNTVTLFRL 257
16767805  240 AEVIADTLYRNTITLFRL 257
194446554 240 AEVIADTLYRNTITLFRL 257
207859689 240 AEVIADTLYRNTITLFRL 257
205355283 240 AEVIADTLYRNTITLFRL 257
194448325 240 AEVIADTLYRNTITLFRL 257
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap