Conserved Protein Domain Family
PRK11431

?
PRK11431: PRK11431 
quaternary ammonium compound efflux SMR transporter SugE
Statistics
?
PSSM-Id: 171110
View PSSM: PRK11431
Aligned: 46 rows
Threshold Bit Score: 123.815
Threshold Setting Gi: 218927558
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157147877   1 MSWIILFIAGLLEVVWAVGLKYTHGFSRLTPSVITIAAMIVSMALLSWAMKTLPVGTAYAVWTGIGAVGAAITGILLLGE 80 
197287387   1 MSWIILFVAGLLEIVWAVGLKYTHGFTRLTPSIITISAMIVSMGMLSYAMKGLPAGTAYAIWTGIGAVGTAIFGIIVFGE 80 
161505158   1 MSWIILLIAGLLEVVWAVGLKYTHGFSRLTPSIITITAMIISMALLSWAMKTLPVGTAYAIWTGIGAVGAAITGILLLGE 80 
16767587    1 MSWIILLIAGLLEVVWAVGLKYTHGFSRLTPSIITITAMVISMALLSWAMKTLPVGTAYAIWTGIGAVGAAITGILLLGE 80 
62182787    1 MSWIILLIAGLLEVVWAVGLKYTHGFSRLTPSIITITAMVISMALLSWAMKTLPVGTAYAIWTGIGAVGAAITGILLLGE 80 
207859487   1 MSWSILLIAGLLEVVWAVGLKYTHGFSRLTPSIITITAMVISMALLSWAMKTLPVGTAYAIWTGIGAVGAAITGILLLGE 80 
218927558   1 MAWIILVIAGLLEVIWAIGLKYSHGFSRLTPSIITLVAMAASVFLLAYAMKSLPAGTAYAVWTGIGAVGTAILGIVLLGE 80 
51594761    1 MAWIILVIAGLLEVIWAIGLKYSHGFSRLTPSIITLVAMAASVFLLAYAMKSLPAGTAYAVWTGIGAVGTAILGIVLLGE 80 
153947543   1 MAWIILVIAGLLEVIWAIGLKYSHGFSRLTPSIITLVAMAASVFLLAYAMKSLPAGTAYAVWTGIGAVGTAILGIVLLGE 80 
253991226   1 MSWFILVIAGLFEVVWAVGLKYTHGFTRLIPSLMTVSAIALSMGLLAYAMKGLPVGTAYAVWTGIGAVGTAIFGIIVLGE 80 
157147877  81 SASPARLASLALIVAGIIGLKLSAH 105
197287387  81 SANIYRLLSLAMIVFGIIGLKLAS- 104
161505158  81 SASPTRLLSLGLIVAGIIGLKLSTH 105
16767587   81 SASPARLLSLGLIVAGIIGLKLSAH 105
62182787   81 SASPARLLSLGLIVAGIIGLKLSAH 105
207859487  81 SASPARLLSLGLIVAGIIGLKLSAH 105
218927558  81 SASLARILSLGLILAGIIGLKLAS- 104
51594761   81 SASLARILSLGLILAGIIGLKLAS- 104
153947543  81 SASLARILSLGLILAGIIGLKLAS- 104
253991226  81 SASIAKVLSLVLIVAGIIGLKLTS- 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap