Conserved Protein Domain Family
PRK11409

?
PRK11409: PRK11409 
YoeB-YefM toxin-antitoxin system antitoxin YefM
Statistics
?
PSSM-Id: 171099
View PSSM: PRK11409
Aligned: 31 rows
Threshold Bit Score: 123.498
Threshold Setting Gi: 51593950
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161486192  1 MRTISYSEARQNLSATMMKAVEDHAPILITRQNGEACVLMSLEEYNSLEETAYLLRSPANARRLMDSIDSLKSGKGTEKD 80 
30063468   1 MRTISYSEARQNLSATMMKAVEDHAPILITRQNGEACVLMSLEEYNSLEETAYLLRSPANARRLMDSIDSLKSGKGTEKD 80 
110805991  1 MRTISYSEARQNLSATMMKAVEDHAPILITRQNGEACVLMSLEEYNSLEETAYLLRSPANARRLMDSIDSLKSGKGTEKD 80 
161984963  1 MRTISYSEARQNLSATMMKAVEDHAPILITRQNGEACVLMSLEEYNSLEETAYLLRSPANARRLMDSIDSLKSGKGTEKD 80 
187731203  1 MRTISYSEARQNLSATMMKAVEDHAPILITRQNGEACVLMSLEEYNSLEETAYLLRSPANARRLMDSIDSLKSGKGTEKD 80 
74312560   1 MRTISYSEARQNLSATMMKAVEDHAPILITRQNGEACVLMSLEEYNSLEETAYLLRSPANARRLMDSIDSLKSGKGTEKD 80 
51593950   1 MRTVNYSEARQNLAATMVKTVEDRAPVLITRQNGSACVLMSLEEYESLEETAYLMRSPANAMNLMSSIEELRGGKGTERK 80 
123440709  1 MRTISYSEARQNLSTTMVQTVEDRAPILITRQNGTSCVLMSLEEYESLEETAYLLRSPANAKHLMDSIEELRAGKGIQRE 80 
126208742  1 MQAITYTEARQNLAGTMSKVAEDFEPILITRSKGGNCVLMSYEQYSSLEETAYLMRSPANAQRLLDSMAELKQGKGIERE 80 
50119395   1 MRTISYSEARQNLSATMMKTVEDRAPILITRQNGEACVLMSLEEYNSLEETAYLLRSPANAKRLMNSIESLKAGNSEERD 80 
161486192 81 IIE 83 
30063468  81 IIE 83 
110805991 81 IIE 83 
161984963 81 IIE 83 
187731203 81 IIE 83 
74312560  81 IIE 83 
51593950  81 LAE 83 
123440709 81 LEA 83 
126208742 81 LIE 83 
50119395  81 IIE 83 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap