Conserved Protein Domain Family
PRK11401

?
PRK11401: PRK11401 
enamine/imine deaminase
Statistics
?
PSSM-Id: 105214
View PSSM: PRK11401
Aligned: 36 rows
Threshold Bit Score: 240.353
Threshold Setting Gi: 218706737
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157148685   1 MRKIIATQHAPGAIGPYVQGVDLGSMVLTSGQIPVCPQTGEVAENVVDQARQSLENVKAIVEAAGLKVGDIVKTTVFITD 80 
291284489  22 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 101
254163057   1 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 80 
260845927   1 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 80 
170018634   1 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 80 
56480265    1 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 80 
30064456    1 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 80 
110806995  22 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 101
82545371   22 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 101
187732750   1 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 80 
157148685  81 LNDFTTINEVYQQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRGD 129
291284489 102 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 150
254163057  81 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 129
260845927  81 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 129
170018634  81 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 129
56480265   81 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 129
30064456   81 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 129
110806995 102 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 150
82545371  102 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 150
187732750  81 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap