Conserved Protein Domain Family
etp

?
PRK11391: etp 
phosphotyrosine-protein phosphatase; Provisional
Statistics
?
PSSM-Id: 138553
View PSSM: PRK11391
Aligned: 28 rows
Threshold Bit Score: 300.782
Threshold Setting Gi: 146312358
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146312358   1 MINSILVVCTGNICRSPIGERLLRQQMPGLTVASAGVSGLVGHSADARAREVAALHGISLEGHIAQKLTLELMRAYDLIL 80 
291281981   5 KFNSILVVCTGNICRSPIGERLLRKRLPGVKVKSAGVHGLVKHPADATAADVAANHGVSLEGHAGRKLTAEMARNYDLIL 84 
254161095   5 KFNSILVVCTGNICRSPIGERLLRKRLPGVKVKSAGVHGLVKHPADATAADVAANHGVSLEGHAGRKLTAEMARNYDLIL 84 
260843230   5 KFNSILVVCTGNICRSPIGERLLRKRLPGVKVKSAGVHGLVKHPADATAADVAANHGVSLEGHAGRKLTAEMARNYDLIL 84 
170020618   5 KFNSILVVCTGNICRSPIGERLLRKRLPGVKVKSAGVHGLVKHPADATAADVAANHGVSLEGHAGRKLTAEMARNYDLIL 84 
161485926   5 KFNSILVVCTGNICRSPIGERLLRKRLPGVKVKSAGVHGLVKHPADATAADVAANHGVSLEGHAGRKLTAEMARNYDLIL 84 
110804996   9 KFNSILVVCTGNICRSPIGERLLRKRLPGVKVKSAGVHGLVKHPADATAADVAANHGVSLEGHAGRKLTAEMARNYDLIL 88 
161984908   5 KFNSILVVCTGNICRSPIGERLLRKRLPGVKVKSAGVHGLVKHPADATAADVAANHGVSLEGHAGRKLTAEMARNYDLIL 84 
187733751   5 KFNSILVVCTGNICRSPIGERLLRKRLPGVKVKSAGVHGLVKHPADATAADVAANHGVSLEGHAGRKLTAEMARNYDLIL 84 
161950139   5 KFNSILVVCTGNICRSPIGERLLRKRLPGVKVKSAGVHGLVKHPADATAADVAANHGVSLEGHAGRKLTAEMARNYDLIL 84 
146312358  81 AMEPEHLNHISSIAPEIRGRSLLFGQWLQPREIPDPFRKSHEAYEYVFDLLGRASQEWTQRLSH 144
291281981  85 AMESEHIAQVTAIAPEVRGKTMLFGQWLEQKEIPDPYRKSQDAFEHVYGMLERASQEWAKRLSR 148
254161095  85 AMESEHIAQVTAIAPEVRGKTMLFGQWLEQKEIPDPYRKSQDAFEHVYGMLERASQEWAKRLSR 148
260843230  85 AMESEHIAQVTAIAPEVRGKTMLFGQWLEQKEIPDPYRKSQDAFEHVYGMLERASQEWAKRLSR 148
170020618  85 AMESEHIAQVTAIAPEVRGKTMLFGQWLEQKEIPDPYRKSQDAFEHVYGMLERASQEWAKRLSR 148
161485926  85 AMESEHIAQVTAIAPEVRGKTMLFGQWLEQKEIPDPYRKSQDAFEHVYSMLERASQEWAKRLSR 148
110804996  89 AMESEHIAQVTAIAPEVRGKTMLFGQWLEQKEIPDPYRKSQDAFEHVYGMLERASQEWAKRLSR 152
161984908  85 AMESEHIAQVTAIAPEVRGKTMLFGQWLEQKEIPDPYRKSQDAFEHVYGMLERASQEWAKRLSR 148
187733751  85 AMESEHIAQVTAIAPEVRGKTMLFGQWLEQKEIPDPYRKSQDAFEHVYGMLERASQEWAKRLSR 148
161950139  85 AMESEHIAQVTAIAPEVRGKTMLFGQWLEQKEIPDPYRKSQDAFEHVYGMLERASQEWAKRLSR 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap