Conserved Protein Domain Family
PRK11383

?
PRK11383: PRK11383 
YiaB family inner membrane protein
Statistics
?
PSSM-Id: 105206
View PSSM: PRK11383
Aligned: 36 rows
Threshold Bit Score: 265.357
Threshold Setting Gi: 238897026
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
152972433   1 MENKHATYSPAFHLISWIALIGGIVTYLVGLWNADMQLNEKGYYFAVLVLGLFAAASYQKTVRDKYEAIPTTALYYTTCL 80 
26250204    2 MDNKISTYSPAFSIVSWVALIGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTPIYYMTCL 81 
110643810   1 MDNKISTYSPAFSIVSWVALIGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTPIYYMTCL 80 
91213076    2 MDNKISTYSPAFSIVSWVALIGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTPIYYMTCL 81 
117625845   1 MDNKISTYSPAFSIVSWVALIGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTPIYYMTCL 80 
218560638   1 MDNKISTYSPAFSIVSWVALIGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTPIYYMTCL 80 
218702329   1 MDNKISTYSPAFSIVSWIALVGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTSIYYMTCL 80 
215488847   1 MDNKISTYSPAFSIVSWVALIGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTPIYYMTCL 80 
288933061   1 MENKHATYSPAFHLISWIALIGGIVTYLVGLWNADMQLNEKGYYFAVLVLGLFAAASYQKTVRDKYEAIPTTALYYTTCL 80 
238897026   2 MENKHATYSPAFHLISWITLIGGIVTYLVGLWNADMQLNEKGYYFAVLVLGLFAAASYQKTVRDKYEAIPTTALYYTTCL 81 
152972433  81 VVFVIAVGLLVIGLWNATLLLSEKGFYGLAYFLSLFGAVAVQKNVRDV-WDPTRLREplsVTEEGPET 147
26250204   82 TVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIRDAgINPPKETQ---VTQEEYSE 146
110643810  81 TVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIRDAgINPPKETQ---VTQEEYSE 145
91213076   82 TVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIHDAgINPPKETQ---VTQEEYSE 146
117625845  81 TVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIHDAgINPPKETQ---VTQEEYSE 145
218560638  81 TVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIHDAgINPPKETQ---VTQEEYSE 145
218702329  81 TVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIRDAgINPPKETQ---VTQEEYSE 145
215488847  81 TVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIRDAgINPPKETQ---VTQEEYSE 145
288933061  81 VVFVIAVGLLVIGLWNATLLLSEKGFYGLAYFLSLFGAVAVQKNVRDA-WDPTRLREplsVTEEGPES 147
238897026  82 VVFVIAVGLLVIGLWNATLLLSEKGFYGLAYFLSLFGAVAVQKNVRDV-WDPTRLREplsVTEEGPET 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap