Conserved Protein Domain Family
PRK10943

?
PRK10943: PRK10943 
cold shock-like protein CspC; Provisional
Statistics
?
PSSM-Id: 170841
View PSSM: PRK10943
Aligned: 90 rows
Threshold Bit Score: 118.632
Threshold Setting Gi: 71892224
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157145410  1 MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKGPAAVNVTAI 69 
219681685  1 MAKIKGQVKWFNESKGFGFITPSDGSKDVFVHFSSIQGNGFKTLTEGQNVEFEIQDGQKGPAAVNVFSL 69 
15616931   1 MAKIKGQVKWFNESKGFGFITPSDGSKDVFVHFSSIQGNGFKTLTEGQNVEFEIQDGQKGPAAVNVFSL 69 
219682240  1 MAKIKGQVKWFNESKGFGFITPSDGSKDVFVHFSSIQGNGFKTLTEGQNVEFEIQDGQKGPAAVNVFSL 69 
50121319   1 MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKGPSAVNVTAL 69 
261821484  1 MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKGPSAVNVTAL 69 
253688307  1 MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKGPSAVNVTAL 69 
71892224   1 MAKIKGQVKWFNESKGFGFITPSDGSKDVFVHFSAIQGNGFKTLSEGQSVEFEIQDGHKGPSAVNVTAL 69 
242239458  1 MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGTGFKTLAEGQNVEFEIQDGQKGPSAVNVTAL 69 
271500505  1 MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKGPSAVNVVAL 69 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap