Conserved Protein Domain Family
PRK10753

?
PRK10753: PRK10753 
DNA-binding protein HU-alpha
Statistics
?
PSSM-Id: 138142
View PSSM: PRK10753
Aligned: 90 rows
Threshold Bit Score: 138.371
Threshold Setting Gi: 238918150
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157147203  1 MNKTQLIDVIADKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFV 80 
218930736  1 MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDPVQLVGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFV 80 
45442848   1 MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDPVQLVGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFV 80 
162418414  1 MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDPVQLVGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFV 80 
108809595  1 MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDPVQLVGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFV 80 
108810400  1 MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDPVQLVGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFV 80 
145600976  1 MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDPVQLVGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFV 80 
51594652   1 MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDPVQLVGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFV 80 
153947801  1 MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDPVQLVGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFV 80 
170022612  1 MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDPVQLVGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFV 80 
157147203 81 SGKALKDAVK 90 
218930736 81 SGKALKDAVK 90 
45442848  81 SGKALKDAVK 90 
162418414 81 SGKALKDAVK 90 
108809595 81 SGKALKDAVK 90 
108810400 81 SGKALKDAVK 90 
145600976 81 SGKALKDAVK 90 
51594652  81 SGKALKDAVK 90 
153947801 81 SGKALKDAVK 90 
170022612 81 SGKALKDAVK 90 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap