Conserved Protein Domain Family
PRK10739

?
PRK10739: PRK10739 
YhgN family NAAT transporter
Statistics
?
PSSM-Id: 170674
View PSSM: PRK10739
Aligned: 71 rows
Threshold Bit Score: 260.407
Threshold Setting Gi: 71892344
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
27904880    1 MKEIISVTILLILIMDPLGNLPIFMSILKHLEPQRRKKILIREMMIALLIMLLFLFAGEKILIFLNLRAETVSVSGGIIL 80 
123444193   1 ---MIAATVLLFLIMDPLGNLPIFMSVLKHLEPKRRRVVLIRELLIALILMLIFLFAGEKILAFLNLRTETVSISGGIIL 77 
85060309    1 MSEMISATVLLFLIIDPLGNLPIFMSVLKHLEPKRRRIIVIREMLMALLLMLIFLFAGKHILSFLNLRTETVSISGGIIL 80 
261823368   1 MTEMISATVLLLLIMDPLGNLPIFMSVLKHLDPKRRRVVLIREMLIALGLMLIFLFAGEHILAFLNLRTETVSISGGIVL 80 
253690302   1 MTEMISATVLLLLIMDPLGNLPIFMSVLKHLDPKRRRVVLIREMLIALGLMLIFLFAGERILAFLNLRTETVSISGGIVL 80 
242237726   1 MTEMISATVLLLLIMDPLGNLPIFMSVLKHLDPKRRRKVLIREMIIALAVMLVFLFAGEKILAFLNLRTETVSISGGIVL 80 
271502356   1 MTEMISATVLLLLIMDPLGNLPVFMSVLKHLDPKRRRVVLIREMIIALGVMLVFLFAGEKILAILNLRTETVSISGGIVL 80 
251787869   1 MTEMISATVLLLLIMDPLGNLPVFMSVLKHLDPKRRRVVLIREMIIALGVMLVFLFAGEKILAILNLRTETVSISGGIVL 80 
33520018    1 MNEMISATILLFLIMDPIGNLPIFMSILKNLNPNRRQIIIIREMIIALLLMLSFLFIGEHILQFLNLQTETVSISGGIVL 80 
50123077    1 MTEMISATVLLLLIMDPLGNLPIFMSVLKHLDPKRRRVVLIREMLIALGLMLIFLFAGEHILAFLNLRTETVSISGGIVL 80 
27904880   81 FLIAIKMIFPTyeSKKKSGNIIKREEPFLVPLAIPLVAGPSLLATLMLLSHQYPKKILYLIGSLLIAWMITVVILLLSDI 160
123444193  78 FLIAIKMIFPS--PESSVTGLSAGEEPFLVPLAIPLVAGPSILATLMLLSHQYPNQLSHLVLALMIAWGLSAAILLMSNL 155
85060309   81 FLIAIKMIFPS--QEGNSSGLPAGEEPFLVPLAIPLVAGPSIIAALMLLSHQYPLQINHLLLALLIAWGLSVVILMLSNV 158
261823368  81 FLIAIRMIFPS--QEGNSSGLPAGEEPFLVPMAIPLVAGPSILAALMLLSHQYPDQLPHLTLALFIAWTISFIILLMSDL 158
253690302  81 FLIAIRMIFPS--QEGNSSGLPAGEEPFLVPMAIPLVAGPSILAALMLLSHQYPNQLPHLTLALFIAWSISFIILLMSDV 158
242237726  81 FLIAIRMIFPS--QEGFTSGLPAGDEPFLVPLAIPMVAGPSILAALMLLSHQYPNQLPHLTLALFIAWAITITVLLLSNL 158
271502356  81 FLIAIRMIFPT--QEGFTSGLPAGDEPFLVPLAIPMVAGPSILAALMLLSHQYPDQLPHLTLALLIAWAITVVVLLLSNL 158
251787869  81 FLIAIRMIFPT--QEGFTSGLPAGDEPFLVPLAIPMVAGPSILAALMLLSHQYPNQMPHLTLALFIAWGITVVVLLLSNL 158
33520018   81 FLIAIKMIFPN--QEGNTSGFANEEEPFLVPLAIPLVAGPSILATLLLLHHQYPNDTNLLIVALIIAWGFSVLILMLSNL 158
50123077   81 FLIAIRMIFPS--QEGNSSGLPAGEEPFLVPMAIPLVAGPSILAALMLLSHQYPNQLSHLTLALFIAWTISFIILLMSDL 158
27904880  161 FLRLFGSKGVNALERLMGLILIMLSTQMFLDGIKSWFYI 199
123444193 156 FLRLLGSKGVSALERLMGLILVMLSTQMFLDGVRAYLTK 194
85060309  159 FLRLLGNKGVSALERLMGLLLLMISTQMFLDGVRTYLHA 197
261823368 159 FLRLLGEKGVSALEKLMGLILVMLSTQMFLDGIRAYMKL 197
253690302 159 FLRLLGEKGVSALEKLMGLILVMLSTQMFLDGVRAYMKL 197
242237726 159 FLRLLGDKGVNALERLMGLVLVMISTQMFLDGIRAYLKL 197
271502356 159 FLRLLGDKGVNALERLMGLVLVMLSTQMFLDGIRAYLKL 197
251787869 159 FLRLLGDKGVNALERLMGLVLVMLSTQMFLDGIRAYLKL 197
33520018  159 FSRLLGNKGINALERLMGLLLIMISTQMLLDGIRNYLHT 197
50123077  159 FLRLLGEKGVSALEKLMGLILVMLSTQMFLDGIRAYMKL 197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap