Conserved Protein Domain Family
PRK10721

?
PRK10721: PRK10721 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 170660
View PSSM: PRK10721
Aligned: 79 rows
Threshold Bit Score: 120.743
Threshold Setting Gi: 260598916
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157144538  1 MGLKWTDSREIGEALYDAFPDLDPKTVRFTDLHQWICDLEDFDDDPQASNEKILEAILLVWLDEAE 66 
108808325  1 MSLTWQDTREIAEALYERFPDTDPKTVRFTDMHQWICELDGFDDDPQRSNEKVLEAILLVWLDEFE 66 
108811410  1 MSLTWQDTREIAEALYERFPDTDPKTVRFTDMHQWICELDGFDDDPQRSNEKVLEAILLVWLDEFE 66 
145599507  1 MSLTWQDTREIAEALYERFPDTDPKTVRFTDMHQWICELDGFDDDPQRSNEKVLEAILLVWLDEFE 66 
51597169   1 MSLTWQDTREIAEALYERFPDTDPKTVRFTDMHQWICELDGFDDDPQRSNEKVLEAILLVWLDEFE 66 
153949156  1 MSLTWQDTREIAEALYERFPDTDPKTVRFTDMHQWICELDGFDDDPQRSNEKVLEAILLVWLDEFE 66 
170023528  1 MSLTWQDTREIAEALYERFPDTDPKTVRFTDMHQWICELDGFDDDPQRSNEKVLEAILLVWLDEFE 66 
186896263  1 MSLTWQDTREIAEALYERFPDTDPKTVRFTDMHQWICELDGFDDDPQRSNEKVLEAILLVWLDEFE 66 
123441408  1 MSLTWQDTREIGEALYDQFPDTDPKTVRFTDMHQWICDLEDFDDDPQGSNEKVLEAILLVWLDEFE 66 
253988849  1 MSLKWSDSREIAEALYDKFPNLDPKTVRFTDMHQWICELDDFNDAPEKSNEKILEAILLIWLDEFE 66 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap