Conserved Protein Domain Family
PRK10664

?
PRK10664: PRK10664 
DNA-binding protein HU-beta
Statistics
?
PSSM-Id: 170612
View PSSM: PRK10664
Aligned: 80 rows
Threshold Bit Score: 140.956
Threshold Setting Gi: 194735846
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157146943  1 MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEITIAAAKVPGFR 80 
51595312   1 MNKSQLIDKIAAGADISKAAAGRALDAIITSVTESLKEGDDVALVGFGTFAVRERSARTGRNPQTGKEISIPAAKVPGFR 80 
153946890  1 MNKSQLIDKIAAGADISKAAAGRALDAIITSVTESLKEGDDVALVGFGTFAVRERSARTGRNPQTGKEISIPAAKVPGFR 80 
170025448  1 MNKSQLIDKIAAGADISKAAAGRALDAIITSVTESLKEGDDVALVGFGTFAVRERSARTGRNPQTGKEISIPAAKVPGFR 80 
186894329  1 MNKSQLIDKIAAGADISKAAAGRALDAIITSVTESLKEGDDVALVGFGTFAVRERSARTGRNPQTGKEISIPAAKVPGFR 80 
50120090   1 MNKSQLIDKIAADADISKAAAGRVLDAIIGSVTESLKEGDDVALVGFGTFSVRERAARTGRNPQTGKEISIPAAKVPGFR 80 
261822504  1 MNKSQLIDKIAADADISKAAAGRVLDAIIGSVTESLKEGDDVALVGFGTFSVRERAARTGRNPQTGKEISIPAAKVPGFR 80 
253687446  1 MNKSQLIDKIAADADISKAAAGRVLDAIIGSVTESLKEGDDVALVGFGTFSVRERAARTGRNPQTGKEISIPAAKVPGFR 80 
271499600  1 MNKSQLIDKIAADADISKAAAGRVLDAIIGSVTESLKAGDDVALVGFGTFSVRERAARTGRNPQTGKEISIPAAKVPGFR 80 
251790645  1 MNKSQLIDKIAADADISKAAAGRVLDAIIGSVTESLKAGDDVALVGFGTFSVRERAARTGRNPQTGKEISIPAAKVPGFR 80 
157146943 81 AGKALKDAVN 90 
51595312  81 AGKGLKDAVN 90 
153946890 81 AGKGLKDAVN 90 
170025448 81 AGKGLKDAVN 90 
186894329 81 AGKGLKDAVN 90 
50120090  81 AGKTLKDAVN 90 
261822504 81 AGKTLKDAVN 90 
253687446 81 AGKTLKDAVN 90 
271499600 81 AGKALKDSVN 90 
251790645 81 AGKALKDSVN 90 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap