Conserved Protein Domain Family
PRK10515

?
PRK10515: PRK10515 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 170492
View PSSM: PRK10515
Aligned: 75 rows
Threshold Bit Score: 97.6626
Threshold Setting Gi: 157370463
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157148089  3 LPRITQKEMTEREQRELKTLLDRARIAHGRPLTNAETNSVKKEYIDKLMALREAEAKKARQLKKKQAYKPDTeASFSWSA 82 
45441944   1 MKKLTLKEMTESEQRDVKTQLDRARINLGRALTNSEQNKVKDEAIEKIMHAREQIAKLTRVERKTKKTAPST-TTFSWSA 79 
108807707  1 MKKLTLKEMTESEQRDVKTQLDRARINLGRALTNSEQNKVKDEAIEKIMHAREQIAKLTRVERKTKKTAPST-TTFSWSA 79 
108811985  1 MKKLTLKEMTESEQRDVKTQLDRARINLGRALTNSEQNKVKDEAIEKIMHAREQIAKLTRVERKTKKTAPST-TTFSWSA 79 
145598083  1 MKKLTLKEMTESEQRDVKTQLDRARINLGRALTNSEQNKVKDEAIEKIMHAREQIAKLTRVERKTKKTAPST-TTFSWSA 79 
51596604   1 MKKLTLKEMTESEQRDVKTQLDRARINLGRALTNSEQNKVKDEAIEKIMHAREQIAKLTRVERKTKKTAPST-TTFSWSA 79 
153950092  1 MKKLTLKEMTESEQRDVKTQLDRARINLGRALTNSEQNKVKDEAIEKIMHAREQIAKLTRVERKTKKTAPST-TTFSWSA 79 
170024123  1 MKKLTLKEMTESEQRDVKTQLDRARINLGRALTNSEQNKVKDEAIEKIMHAREQIAKLTRVERKTKKTAPST-TTFSWSA 79 
186895663  1 MKKLTLKEMTESEQRDVKTQLDRARINLGRALTNSEQNKVKDEAIEKIMHAREQIAKLTRVERKTKKTAPST-TTFSWSA 79 
123442397  1 MKKLTLKEMTESEQRDVKTQLDKARINLGRALTNSEQNKVKDEAIEKIMNAREQIAKLTRVERKTKKTAPST-TTFSWSA 79 
157148089 83 NTPTRGRR 90 
45441944  80 SISTRPPR 87 
108807707 80 SISTRPPR 87 
108811985 80 SISTRPPR 87 
145598083 80 SISTRPPR 87 
51596604  80 SISTRPPR 87 
153950092 80 SISTRPPR 87 
170024123 80 SISTRPPR 87 
186895663 80 SISTRPPR 87 
123442397 80 SISTRPPR 87 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap