Conserved Protein Domain Family
PRK10474

?
PRK10474: PRK10474 
PTS fructose-like transporter subunit IIB
Links
?
Statistics
?
PSSM-Id: 170468
View PSSM: PRK10474
Aligned: 68 rows
Threshold Bit Score: 119.216
Threshold Setting Gi: 116872020
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157147252   1 MAAEALESAAKAKGWEVKVETQGSIGLENELTAADVADADMVILTKDIGIKFEERFAGKTIVRVNISDAVKRADAIMNKI 80 
153949085  19 MAAEALERAARAKGWECKVETQGSIGVENKLTAEDVAAADMVILTKDIGILFEERFAGKVIVRIAVSDAVKRADAIMDKI 98 
170025874  19 MAAEALERAARAKGWECKVETQGSIGVENKLTAEDVAAADMVILTKDIGILFEERFAGKVIVRIAVSDAVKRADAIMDKI 98 
126697779  18 MSAESLELSAKKFGIEIKVETQGSSGIDNELSLKDIDEATCVILTNDVEIRNMERFKGKKVVRMSVSEIIKKSDALIKKI 97 
260681986  18 MSAESLELSAKKFGIEIKVETQGSSGIDNELSLKDIDEATCVILTNDVEIRNMERFKGKKVVRMSVSEIIKKSDALIKKI 97 
260685584  18 MSAESLELSAKKFGIEIKVETQGSSGIDNELSLKDIDEATCVILTNDVEIRNMERFKGKKVVRMSVSEIIKKSDALIKKI 97 
16802675   18 MSAESLELSAKKMGVTIKVETQGSSGIENKLTAKEIEEADCVIITNDVEIRESQRFKGKKVVKMSVSEIIKKSDALIKKL 97 
46906878   18 MSAESLELSAKKMGVTIKVETQGSSGIENKLTAKEIEEADCVIITNDVEIRESQRFKGKKVVKMSVSEIIKKSDALIKKL 97 
284994099  18 MSAESLELSAKKMGVTIKVETQGSSGIENKLTAKEIEEADCVIITNDVEIRESQRFKGKKVVKMSVSEIIKKSDALIKKL 97 
284800913  18 MSAESLELSAKKMGVTIKVETQGSSGIENKLTAKEIEEADCVIITNDVEIRESQRFKGKKVVKMSVSEIIKKSDALIKKL 97 
157147252  81 DAHLSQIA 88 
153949085  99 AAYLEKNT 106
170025874  99 AAYLEKNT 106
126697779  98 KDTFQ--- 102
260681986  98 KDTFQ--- 102
260685584  98 KDTFQ--- 102
16802675   98 QTMFE--- 102
46906878   98 QTMFE--- 102
284994099  98 QTMFE--- 102
284800913  98 QTMFE--- 102
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap