Conserved Protein Domain Family
PRK10424

?
PRK10424: PRK10424 
ilv operon leader peptide
Statistics
?
PSSM-Id: 170429
View PSSM: PRK10424
Aligned: 38 rows
Threshold Bit Score: 27.0897
Threshold Setting Gi: 85060376
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
283787552  1 MTALLRVISLVVISVVVIIIPPCGAALGRGKA 32 
260857826  1 MTALLRVISLVMISVVVIIIPPCGAALGRGKA 32 
16762231   1 MTALLRVISLVVISVVVIIIPPCGAALGRGKA 32 
16767176   1 MTALLRVISLVVISVVVIIIPPCGAALGRGKA 32 
24115062   1 MTALLRVISLVVISVVVIIIPPCGAALGRGKA 32 
30064936   1 MTALLRVISLVVISVVVIIIPPCGAALGRGKA 32 
82546122   1 MTALLRVISLVVISVVVIIIPPCGAALGRGKA 32 
82779051   1 MTALLRVISLVVISVVVIIIPPCGAALGRGKA 32 
74314281   1 MTALLRVISLVVISVVVIIIPPCGAALGRGKA 32 
22124252   1 MKAILQVINLVLISVVVIIIPPCGAALGRRKA 32 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap