Conserved Protein Domain Family
PRK10349

?
PRK10349: PRK10349 
pimeloyl-ACP methyl ester esterase BioH
Statistics
?
PSSM-Id: 137836
View PSSM: PRK10349
Aligned: 52 rows
Threshold Bit Score: 484.521
Threshold Setting Gi: 110807247
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15803916    1 MNNIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLAEMAEAVLRQAPDKAIWLG 80 
224585304   1 MNDIWWQTYGEGNCHLVLLHGWGLNAEVWHCIREELGSHFTLHLVDLPGYGRSSGFGAMTLEEMTAQVAKNAPDQAIWLG 80 
56415424    1 MNDIWWQTYGEGNCHLVLLHGWGLNAEVWHCIREELGSHFTLHLVDLPGYGRSSGFGAMTLEEMTAQVAKNAPDQAIWLG 80 
62182011    1 MNDIWWQTYGEGNCHLVLLHGWGLNAEVWHCIREELGSHFTLHLVDLPGYGRSSGFGAMTLEEMTAQVAKNAPDQAIWLG 80 
16766797    1 MNDIWWQTYGEGNCHLVLLHGWGLNAEVWHCIREELGSHFTLHLVDLPGYGRSSGFGAMTLEEMTAQVAKNAPDQAIWLG 80 
194448674   1 MNDIWWQTYGEGNCHLVLLHGWGLNAEVWHCIREELGSHFTLHLVDLPGYGRSSGFGAMTLEEMTAQVAKNAPDQAIWLG 80 
198246112   1 MNDIWWQTYGEGNCHLVLLHGWGLNAEVWHCIREELGSHFTLHLVDLPGYGRSSGFGAMTLEEMTAQVAKNAPDQAIWLG 80 
194446498   1 MNDIWWQTYGEGNCHLVLLHGWGLNAEVWHCIREELGSHFTLHLVDLPGYGRSSGFGAMTLEEMTAQVAKNAPDQAIWLG 80 
197250937   1 MNDIWWQTYGEGNCHLVLLHGWGLNAEVWHCIREELGSHFTLHLVDLPGYGRSSGFGAMTLEEMTAQVAKNAPDQAIWLG 80 
194737196   1 ----------------MLLHGWGLNAEVWHCIREELGSHFTLHLVDLPGYGRSSGFGAMTFEEMTAQVAKNAPDQAIWLG 64 
15803916   81 WSLGGLVASQIALTHPERVQALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARA 160
224585304  81 WSLGGLVASQMALTHPERVQALVTVASSPCFSAREGWPGIKPEILGGFQQQLSDDFQRTVERFLALQTLGTETARQDART 160
56415424   81 WSLGGLVASQMALTHPERVQALVTVASSPCFSAREGWPGIKPEILGGFQQQLSDDFQRTVERFLALQTLGTETARQDART 160
62182011   81 WSLGGLVASQMALTHPERVQALVTVASSPCFSAREGWPGIKPEILGGFQQQLSDDFQRTVERFLALQTLGTETARQDART 160
16766797   81 WSLGGLVASQMALTHPERVQALVTVASSPCFSAREGWPGIKPEILGGFQQQLSDDFQRTVERFLALQTLGTETARQDART 160
194448674  81 WSLGGLVASQMALTHPERVQALVTVASSPCFSAREGWPGIKPEILGGFQQQLSDDFQRTVERFLALQTLGTETARQDART 160
198246112  81 WSLGGLVASQMALTHPERVQALVTVASSPCFSAREGWPGIKPEILGGFQQQLSDDFQRTVERFLALQTLGTETARQDART 160
194446498  81 WSLGGLVASQMAFTHPERVQALVTVASSPCFSAREGWPGIKPEILGGFQQQLSDDFQRTVERFLALQTLGTETARQDART 160
197250937  81 WSLGGLVASQMALTHPERVQALVTVASSPCFSAREGWPGIKPEILGGFQQQLSDDFQRTVERFLALQTLGTETARQDART 160
194737196  65 WSLGGLVASQMALTHPERVQALVTVASSPCFSAREGWPGIKPEILGGFQQQLSDDFQRTVERFLALQTLGTETARQDART 144
15803916  161 LKKTVLALPMPEVDVLNGGLEILKTVDLRLPLQNVPMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIFAKAAHAPFIS 240
224585304 161 LKSVVLAQPMPDVEVLNGGLEILKTVDLREALKNVNMPFLRLYGYLDGLVPRKIAPLLDTLWPHSTSQIMAKAAHAPFIS 240
56415424  161 LKSVVLAQPMPDVEVLNGGLEILKTVDLREALKNVNMPFLRLYGYLDGLVPRKIAPLLDTLWPHSTSQIMAKAAHAPFIS 240
62182011  161 LKSVVLAQPMPDVEVLNGGLEILKTVDLREALKNVNMPFLRLYGYLDGLVPRKIAPLLDTLWPHSTSQIMAKAAHAPFIS 240
16766797  161 LKSVVLAQPMPDVEVLNGGLEILKTVDLREALKNVNMPFLRLYGYLDGLVPRKIVPLLDTLWPHSTSQIMAKAAHAPFIS 240
194448674 161 LKSVVLAQPMPDVEVLNGGLEILKTVDLREALKNVNMPFLRLYGYLDGLVPRKIVPLLDTLWPHSTSQIMAKAAHAPFIS 240
198246112 161 LKSVVLAQPMPDVEVLNGGLEILKTVDLREALKNVNMPFLRLYGYLDGLVPRKIVPLLDTLWPHSTSQIMAKAAHAPFIS 240
194446498 161 LKSVVLAQPMPDVEVLNGGLEILKTVDLREALKNVNMPFLRLYGYLDGLVPRKIAPLLDTLWPHSTSQIMEKAAHAPFIS 240
197250937 161 LKSVVLAQPMPDVEVLNGGLEILKTVDLREALKNVNMPFLRLYGYLDGLVPRKMVPLLDTLWPHSTSQIMAKAAHAPFIS 240
194737196 145 LKSVVLAQPMPDVDVLNGGLEILKTVDLREALKNVNMPFLRLYGYLDGLVPRKIVPLLDTLWPHSTSQIMAKAAHAPFIS 224
15803916  241 HPVEFRHVLVALKQRV 256
224585304 241 HPAAFCQALMTLKSSL 256
56415424  241 HPAAFCQALMTLKSSL 256
62182011  241 HPAAFCQALMTLKSSL 256
16766797  241 HPAAFCQALMTLKSSL 256
194448674 241 HPAAFCQALMTLKSSL 256
198246112 241 HPAAFCQALMTLKSSL 256
194446498 241 HPAAFCQALMTLKSSL 256
197250937 241 HPAAFCQALMTLKSSL 256
194737196 225 HPAAFCQALMTLKSSL 240
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap