Conserved Protein Domain Family
PRK10259

?
PRK10259: PRK10259 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 137782
View PSSM: PRK10259
Aligned: 52 rows
Threshold Bit Score: 100.18
Threshold Setting Gi: 194737466
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146310949  38 MKTIKYAVAAIALTTLSFGAFAAQSVTEAQAQNMNKLGVVSAEGATTLDGLEAKLAEKASAAGASGYTITSANSNNKLSG 117
62179390   38 MKTIKYAVAAIALSTLSFGAFAAEPVSASQTQNLHKIGVVSADGATTLDGLEAKLAEKAAAAGASAYNITSAVGNDKMSG 117
207856260   1 MKTIKYAVAAIALSTLSFGAFAAEPVSASQTQNLHKIGVVSADGATTLDGLEAKLAEKAAAAGASAYNITSAVGNDKMSG 80 
161504010   1 MKTIKYAVAAIALSTLSFGVFAAEPVSASQTQNLHKIGVVSADGATTLDGLEAKLAEKAAAAGAIAYNITSAVGNDKMSG 80 
56414077    1 MKTIKYAVAAIALSTLSFGVFAAEPVSASQTQNLHKIGVVSADGATTLDGLEAKLAEKAAAAGASAYNITSAVGNDKMSG 80 
161614928   1 MKTIKYAVAAIALSTLSFGAFAAEPVSASQTQNLHKIGVVSADGATTLDGLEAKLAEKAAAAGASAYNITSAVGNDKMSG 80 
224582636   1 MKTIKYAVAAIALSTLSFGAFAAEPVSASQTQNLHKIGVVSADGATTLDGLEAKLAEKAAAAGASAYNITSAVGNDKMSG 80 
197250648   1 MKTIKYAVAAIALSTLSFGAFAAEPVSASQTQNLHKIGVVSADGATTLDGLEAKLAEKAAAAGASAYNITSAVGNDKMSG 80 
205352080   1 MKTIKYAVAAIALSTLSFGAFAAEPVSASQTQNLHKIGVVSADGATTLDGLEAKLAEKAAAAGASAYNITSAVGNDKMSG 80 
194449691   1 MKTIKYAVAAIALSTLSFGAFAAEPVSASQTQNLHKIGVVSADGATTLDGLEAKLAEKAAAAGASAYNITSAVGNDKMSG 80 
146310949 118 TAVIYQ 123
62179390  118 TAVIYK 123
207856260  81 TAVIYK 86 
161504010  81 TAVIYK 86 
56414077   81 TAVIYK 86 
161614928  81 TAVIYK 86 
224582636  81 TAVIYK 86 
197250648  81 TAVIYK 86 
205352080  81 TAVIYK 86 
194449691  81 TAVIYK 86 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap