Conserved Protein Domain Family
PRK10081

?
PRK10081: PRK10081 
lipoprotein toxin entericidin B
Statistics
?
PSSM-Id: 170240
View PSSM: PRK10081
Aligned: 45 rows
Threshold Bit Score: 68.9492
Threshold Setting Gi: 296100918
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146310000  1 MVKKTIAAIFSVLVLSSVLTACNTTRGVGQDISDGGSAISGAATKAQN 48 
296100918  1 MVKKTIAAIFSVLVLSSVLTACNTTRGVGQDISEGGSAISGAATKAQQ 48 
288937549  1 MVKKTIAAFFTVLVLSSALTACNTTRGVGQDISEGGSAISGAATKAQQ 48 
238892635  1 MVKKTIAAFFTVLVLSSALTACNTTRGVGEDISDGGNAISGAATKAQQ 48 
206580489  1 MVKKTIAAFFTVLVLSSALTACNTTRGVGQDISEGGSAISGAATKAQQ 48 
29144637   1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGSAISGAATRAQQ 48 
16763158   1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGSAISGAATRAQQ 48 
16767585   1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGSAISGAATRAQQ 48 
62182785   1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGSAISGAATRAQQ 48 
207859485  1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGSAISGAATRAQQ 48 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap