Conserved Protein Domain Family
PRK10039

?
PRK10039: PRK10039 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 170217
View PSSM: PRK10039
Aligned: 28 rows
Threshold Bit Score: 152.956
Threshold Setting Gi: 71280622
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
110644342   1 MSVLYIQIRRNQITVRDLESK---REVSG--DAAFSNQRLLIANFFVAEKVLQDLVLQLHPRSTWHSFLPAKRMDIVVSA 75 
108813359   1 MPFFYLQIRKNHLTLKNLDSQ---KVVSG--TANFSTERLLIGEFFIAEACLYPLVSQVLPGFINQLKRRCLRTHILIHA 75 
294502848   1 MPFFYLQIRKNHLTLKNLDSQ---KVVSG--TANFSTERLLIGEFFIAEACLYPLVSQVLPGFINQLKRRCLRTHILIHA 75 
51597574    1 MPFFYLQIRKNHLTLKNLDSQ---KVVSG--TANFSTERLLIGEFFIAEACLYPLVSQVLPGFINQLKRRCLRTHILIHA 75 
153949690   1 MPFFYLQIRKNHLTLKNLDSQ---KVVSG--TANFSTERLLIGEFFIAEACLYPLVSQVLPGFINQLKRRYLRTHILIHA 75 
170023026   1 MPFFYLQIRKNHLTLKNLDSQ---KVVSG--TANFSTERLLIGEFFIAEACLYPLVSQVLPGFINQLKRRCLRTHILIHA 75 
186896709   1 MPFFYLQIRKNHLTLKNLDSQ---KVVSG--TANFSTERLLIGEFFIAEACLYPLVSQVLPGFINQLKRRCLRTHILIHA 75 
71280622   12 TVDLYIKVRKNRFEAKNLSSSgswETIQS--EHPFTTERLLVGTFSAAESALTKLIKSVTPRSFFK-----KSPQIIIQP 84 
253687647   1 MASLYIRIYRDTLTVRNVETK---QEVTEksDTPFTTTRLLLGQMIPAMKLLERLTRKVAAKRLINLFSSH---NVIIHA 74 
50120316    1 MASLYIRIYRDTLTVRNVDTK---KELTEqsEVPFTTTRLLLGQMIPAMKLLDRLARKVAAKRLIDLFCSH---NVIIHA 74 
110644342  76 LEMNEGGLSQVEERILHEVVAGATLMKYRQFHIHAQSVVLSDSAVLAMFKQK 127
108813359  76 QEMLEGGVSQVEQRIMREFTVPSFPKGYHSLYAAPQT--LSDDAVKRIILMG 125
294502848  76 QEMLEGGVSQVEQRIMREFTVPSFPKGYHSLYAAPQT--LSDDAVKRIILMG 125
51597574   76 QEMLEGGVSQVEQRIMREFTVPSFPKGYHSLYAAPQT--LSDDAVKRIILMG 125
153949690  76 QEMLEGGVSQVEQRIMREFTVPSFPKGYHSLYAAPQT--LSDDAVKRIILMG 125
170023026  76 QEMLEGGVSQVEQRIMREFTVPSFPKGYHSLYAAPQT--LSDDAVKRIILMG 125
186896709  76 QEMLEGGVSQVEQRIMREFTVPSFPKGYHSLYAAPQT--LSDDAVKRIILMG 125
71280622   85 MELLDGGLSEVEERIFKELALGSGAFK----VILHTGSELTDSEAMQLIRSA 132
253687647  75 MEMNEGGHSQVEFASYIELAKSISPQG-KHIYVCSKNVPLTDQEVIQIFSGD 125
50120316   75 MEMNEGGHSQVEFASYIELAKSISPQG-KHIYVCSKNVPLTDQEVIQIFSGD 125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap