Conserved Protein Domain Family
PRK09982

?
PRK09982: PRK09982 
universal stress protein UspD; Provisional
Statistics
?
PSSM-Id: 137627
View PSSM: PRK09982
Aligned: 37 rows
Threshold Bit Score: 271.11
Threshold Setting Gi: 110807784
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15804512    1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80 
218692207   1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80 
218701374   1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80 
218707547   1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80 
254795923   1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80 
291285336   1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80 
82778908    1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80 
91213464    1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80 
110644259   1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80 
117626190   1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80 
15804512   81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
218692207  81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
218701374  81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
218707547  81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
254795923  81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
291285336  81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
82778908   81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
91213464   81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
110644259  81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
117626190  81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap