Conserved Protein Domain Family
PRK09979

?
PRK09979: PRK09979 
rho operon leader peptide rhoL
Statistics
?
PSSM-Id: 77522
View PSSM: PRK09979
Aligned: 26 rows
Threshold Bit Score: 40.0208
Threshold Setting Gi: 15804372
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15804372   1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33 
218707418  1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33 
253775593  1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33 
254163726  1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33 
260846442  1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33 
260857812  1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33 
260870507  1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33 
291285197  1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33 
74314296   1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33 
82779037   1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap