Conserved Protein Domain Family
PRK09978

?
PRK09978: PRK09978 
DNA-binding transcriptional regulator GadX; Provisional
Statistics
?
PSSM-Id: 137624
View PSSM: PRK09978
Aligned: 37 rows
Threshold Bit Score: 479.807
Threshold Setting Gi: 218550350
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15804060    1 MQSLHGNCLIAYARHKYILTMVNGEYRYFNGGDLVFADASQIRVDKCVENFVLVSRDTLSLFLPMLKEEALNLHAHKKVS 80 
26250149    1 MQPLHGNCLIAYARHKYILTMVNGEYRYFNGGDLVFADASQIQVDKCVENFVLVSRDTLSLFLPMLKEEALKLHVHKKVP 80 
91213022    1 MQPLHGNCLIAYARHKYILTMVNGEYRYFNGGDLVFADASQIQVDKCVENFVLVSRDTLSLFLPMLKEEALKLHVHKKVP 80 
117625799   1 MQPLHGNCLIAYARHKYILTMVNGEYRYFNGGDLVFADASQIQVDKCVENFVLVSRDTLSLFLPMLKEEALKLHVHKKVP 80 
110643762   1 MQPLHGNCLIAYARHKYILTMVNGEYRYFNGGDLVFADASQIQVDKCVENFVLVSRDTLSLFLPMLKEEALKLHAHKKVP 80 
218702281   1 MQPLHGNCLIAYARHKYILTMVNGEYRYFNGGDLVFADASQIQVDKCVENFVLVSRDTLSLFLPMLKEEALKLHAHKKAP 80 
215488793   1 MQPLHGNCLIAYARHKYILTMVNGEYRYFNGGDLVFADASQIQVDKCVENFVLVSRDTLSLFLPMLKEEALKLHAHKKVP 80 
218707145   1 MQSLHGNCLIAYARHKYILTMVNGEYRYFNGGDLVFADASQIRVDKCGEHFILVSRDTLSLFLPMLKEEALKLHAHKKVP 80 
218560591   1 MQPLHGNCLIAYARHKYILTMVNGEYRYFNGGDLVFADASQIQVDKCVENFVLVSRDTLSLFLPMLKEEALKLHVHKKVP 80 
218691800   1 MQPLHGNCLIAYARHKYILTMVNGEYRYFNGGDLVFADASQIQVDKCVENFVLVSRDTISLFLPMLKEEALKLHVHKKVP 80 
15804060   81 SLLVHHCSRDIPVFQEVAQLSQNKNLRYAEMLRKRALIFALLSVFLEDDHFIPLLLNVLQPNMRTRVCTVINNNIAHEWT 160
26250149   81 SLLVHHCTRDIPVFQEVAQLSQNKNLRYAEMLRKRALIFALLSVFLEDTQFIPLLLNVLQPNMRTRVCTVINNNIAHEWT 160
91213022   81 SLLVHHCTRDIPVFQEVAQLSQNKNLRYAEMLRKRALIFALLSVFLEDTQFIPLLLNVLQPNMRTRVCTVINNNIAHEWT 160
117625799  81 SLLVHHCTRDIPVFQEVAQLSQNKNLRYAEMLRKRALIFALLSVFLEDTQFIPLLLNVLQPNMRTRVCTVINNNIAHEWT 160
110643762  81 SLLVHHCTRDIPVFQEVAQLSQNKNLRYAEMLRKRALIFALLSVFLEDTQFIPLLLNVLQPNMRTRVCTVINNNIAHEWT 160
218702281  81 SLLVHHCIRDIPVFQEVAQLSQNKNLRYAEMLRKRALIFALLSVFLEDTKFIPLLLNVLQPNMRTRVCTVINNNIAHEWT 160
215488793  81 SLLVHHCTRDIPVFQEVAQLSQNKNLRYAEMLRKRALIFALLSVFLEDTQFIPLLLNVLQPNMRTRVCTVINNNIAHEWT 160
218707145  81 SLLVHHCTRDIPVFQEVAQLSQNKNLRYAETLRKRALIFALLSVFLEDEQFIPLLLNVLQPNMRTRVCTVINNNIAHEWT 160
218560591  81 SLLVHHWTRDIPVFQEVAQLSQNKNLRYAEMLRKRALIFALLSVFLEDTQFIPLLLNVLQPNMRTRVCTVINNNIAHEWT 160
218691800  81 SLLVHHCTRDIPVFQEVAQLSQNKNLRYAEMLRKRALIFALLSVFLEDTQFIPLLLNVLQPNMRTRVCTVINNNIAHEWT 160
15804060  161 LARIASELLMSPSLLKKKLREEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQ 240
26250149  161 LARIASELLMSPSLLKKKLREEGTSYSQLLTECRMQRALQLIVIYGVSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQ 240
91213022  161 LARIASELLMSPSLLKKKLREEGTSYSQLLTECRMQRALQLIVIYGVSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQ 240
117625799 161 LARIASELLMSPSLLKKKLREEGTSYSQLLTECRMQRALQLIVIYGVSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQ 240
110643762 161 LARIASELLMSPSLLKKKLREEGTSYSQLLTECRMQRALQLIVIYGVSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQ 240
218702281 161 LARIASELLMSPSLLKKKLREEGTSYSQLLTECRMQRALQLIVIYGVSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQ 240
215488793 161 LARIASELLMSPSLLKKKLREEGTSYSQLLTECRMQRALQLIVIYGVSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQ 240
218707145 161 LARIASELLMSPSLLKKKLREEETSYSQLLTECRMQHALQLIVIHGFSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQ 240
218560591 161 LARIASELLMSPSLLKKKLREEGTSYSQLLTECRMQRALQLIVIYGVSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQ 240
218691800 161 LARIASELLMSPSLLKKKLREEGTSYSQLLTECRMQRALQLIVIYGVSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQ 240
15804060  241 ERSAQGLPNRDSAASIVAQGNFYGTDCSAEGIRL 274
26250149  241 ERSAQELPNCGSAASMAAQGIFYGTDRSAEGIRL 274
91213022  241 ERSAQELPNCGSAASMAAQGIFYGTDRSAEGIRL 274
117625799 241 ERSAQELPNCGSAASMAAQGIFYGTDRSAEGIRL 274
110643762 241 ERSAQELPNCGPAASMAAQGIFYGTDRSAEGIRL 274
218702281 241 ERSAQELPNCGPAASIAAQGNFYGTDRSAEGIRL 274
215488793 241 ERSAQELPNCGPAASMAAQGNFYGTDRSAEGIRL 274
218707145 241 ERSAQGLSNRDSAASIVAQGNFYGTDCSAEGIRL 274
218560591 241 ERSAQELPNCGSAASMAAQGIFYGTDRSAEGIRL 274
218691800 241 ERSAQELPNCGPAASMAAQGIFYGTDRSAEGIRL 274
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap