Conserved Protein Domain Family
PRK09973

?
PRK09973: PRK09973 
lipoprotein YqhH
Statistics
?
PSSM-Id: 170188
View PSSM: PRK09973
Aligned: 38 rows
Threshold Bit Score: 133.969
Threshold Setting Gi: 218550262
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
187731592  1 MKTIFTVGAVVLATCLLSGCVNEQKVNQLASNVQTLNAKIARLEQDMKALRPQIYAAKSEANRANTRLDAQDYFDCLRCL 80 
291284395  1 MKTIFTVGAVVLATCVLSGCVNEQKVNQLASNVQTLNAKIARLEQDMKALRPQIYAAKSEANRANTRLDAQDYFDCLRCL 80 
82778372   1 MKTIFTVGAVVLATCVLSGCVNEQKVNQLASNVQTLNAKIARLEQDMKALRPQIYAAKSEANRANTRLDAQDYFDCLRCL 80 
15803559   1 MKTIFTVGAVVLATCVLSGCVNEQKVNQLASNVQTLNAKIARLEQDMKALRPQIYAAKSEANRANTRLDAQDYFDCLRCL 80 
15833153   1 MKTIFTVGAVVLATCVLSGCVNEQKVNQLASNVQTLNAKIARLEQDMKALRPQIYAAKSEANRANTRLDAQDYFDCLRCL 80 
209396592  1 MKTIFTVGAVVLATCVLSGCVNEQKVNQLASNVQTLNAKIARLEQDMKALRPQIYAAKSEANRANTRLDAQDYFDCLRCL 80 
254794969  1 MKTIFTVGAVVLATCVLSGCVNEQKVNQLASNVQTLNAKIARLEQDMKALRPQIYAAKSEANRANTRLDAQDYFDCLRCL 80 
218691306  1 MKTIFTVGAVVLATCLLSGCVNEQKVNQLASNVQTLNAKIARLEQEMKALRPQIYAAKSEANRANTRLDAQDYFDCLRCL 80 
218550262  1 MKKIFTIGSILLLSSLLSGCVNEAKVNQLATNVQLLNTKITRLEQDIKALRPQIYAAKSEANRANTRLDAQDYFDCLRCL 80 
110643251  1 MKTIFTVGAVVLATCLLSGCVNEQKVNQLASNVQTLNAKIARLEQDMKALRPQIYAAKSDANRANTRLDAQDYFDCLRCL 80 
187731592 81 RMYAE 85 
291284395 81 RMYAE 85 
82778372  81 RMYAE 85 
15803559  81 RMYAE 85 
15833153  81 RMYAE 85 
209396592 81 RMYAE 85 
254794969 81 RMYAE 85 
218691306 81 RMYAE 85 
218550262 81 RMYSD 85 
110643251 81 RMYAE 85 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap