Conserved Protein Domain Family
PRK09945

?
PRK09945: PRK09945 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 137602
View PSSM: PRK09945
Aligned: 36 rows
Threshold Bit Score: 696.463
Threshold Setting Gi: 218689609
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15802078    1 MGSDAKNLMSDGNVQIVKTGEVIGATQLTEGELIVEAGGRAENTVVTGAGWLKVATGGIAKCTQYGNNGTLSVSDGAIAT 80 
15831627    1 MGSDAKNLMSDGNVQIVKTGEVIGATQLTEGELIVEAGGRAENTVVTGAGWLKVATGGIAKCTQYGNNGTLSVSDGAIAT 80 
218558535   1 MGSDAKNLMSDGNVQIVKTGEVIGATQLTEGELIVEAGARAENTVVTGAGWLKVATGGIAKCTQYGNNGTLSVSDGAIAT 80 
91210878    1 MGSDAKNLMSDGNVQIVKTGEVIGATQLTEGELIVEAGARAENTVVTGAGWLKVATGGIAKCTQYGNNGTLSVSDGAIAT 80 
110641787   1 MGSDAKNLMSDGNVQIVKTGEVIGATQLTEGELIVEAGARAENTVVTGAGWLKVATGGIAKCTQYGNNGTLSVSDGAIAT 80 
218689609   1 MGSDAKNLMSDGNVQIVKTGEVIGATQLTEGELIVEAGGRAENTVVTGAGWLKVATGGIAKCTQYGNNGTLSVSDGAIAT 80 
218699768   1 MGSDAKNLMSDGNVQIVKTGEVIGATQLTEGELIVEAGGRAENTVVTGAGWLKVATGGIAKCTQYGNNGTLSVSDGAIAT 80 
82777141    1 MGSDAKNLMSDGNVQIVKTGEVIGATQLTEGELIVEAGGRAENTVVTGAGWLKVTTGGIAKCTQYGNNGTLSVSDGAIAT 80 
170682120   1 MGSDAKNLMSDGNVQIVKTGEVIGATQLTEGELIVEAGGRAENTVVTGAGWLKVATGGIAKCTQYGNNGTLSVSDGAIAT 80 
117623846   1 MGSDAKNLMSDGNVQIVKTGEVIGATQLTEGELIVEAGARAENTVVTGAGWLKVATGGIVKCTQYGNNGTLSVSDGAIAT 80 
15802078   81 DIVQSEGGAISLSTLATVNGRHPEGEFSVDQGYACGLLLENGGNLRVLEGHRAEKIILDQEGGLLVNGTTSAVVVDEGGE 160
15831627   81 DIVQSEGGAISLSTLATVNGRHPEGEFSVDQGYACGLLLENGGNLRVLEGHRAEKIILDQEGGLLVNGTTSAVVVDEGGE 160
218558535  81 DIVQSEGGAISLSTLATVNGRHPEGEFSVDQGYACGLLLENGGNLRVLEGHRAEKIILDQEGGLLVNGTTSAVVVDEGGE 160
91210878   81 DIVQSEGGAISLSTLATVNGRHPEGEFSVDQGYACGLLLENGGNLRVLEGHRAEKIILDQEGGLLVNGTTSAVVVDEGGE 160
110641787  81 DIVQSEGGAISLSTLATVNGRHPEGEFSVDQGYACGLLLENGGNLRVLEGHRAEKIILDQEGGLLVNGTTSAVVVDEGGE 160
218689609  81 DIVQSEGGAISLSTLATVNGRHPEGEFSVDKGYACGLLLENGGNLRVLEGHRAEKIILDQEGGLLVNGTTSAVVVDEGGE 160
218699768  81 DIVQSEGGAISLSTLATVNGRHPEGEFSVDKGYACGLLLENGGNLRVLEGHRAEKIILDQEGGLLVNGTTSAVVVDEGGE 160
82777141   81 DIVQSEGGAISLSTLATVNGRHPEGEFSVDKGYACGLLLENGGNLRVLEGHRAEKIILDQEGGLLVNGTTSAVVVDEGGE 160
170682120  81 DIVQSEGGAISLSTLATVNGRHPEGEFSVDKGYACGLLLENGGNLRVLEGHRAEKIILDQEGGLLVNGTTSAVVVDEGGE 160
117623846  81 DIVQSEGGAISLSTLATVNGRHPEGEFSVDQGYACGLLLENGGNLRVLEGHRAEKIILDQEGGLLVNGTTSAVVVDEGGE 160
15802078  161 LLVYPGGEASNCEINQGGVFMLAGKANDTLLADGTMNNLGGEDSDTIVENGAIYRLGTDGLQLYSSGKTQNLSVNVGGRA 240
15831627  161 LLVYPGGEASNCEINQGGVFMLAGKANDTLLADGTMNNLGGEDSDTIVENGAIYRLGTDGLQLYSSGKTQNLSVNVGGRA 240
218558535 161 LLVYPGGEASNCEINQGGVFMLAGKANDTLLAGGTMNNLGGEDSDTIVENGAIYRLGTDGLQLYSSGKTQNLSVNVGGRA 240
91210878  161 LLVYPGGEASNCEINQGGVFMLAGKANDTLLAGGTMNNLGGEDSDTIVENGAIYRLGTDGLQLYSSGKTQNLSVNVGGRA 240
110641787 161 LLVYPGGEASNCEINQGGVFMLAGKANDTLLAGGTMNNLGGEDSDTIVENGAIYRLGTDGLQLYSSGKTQNLSVNVGGRA 240
218689609 161 LLVYPGGEAYNCEINQGGVFMLAGKASDTLLAGGTMNNLGGEDSDTIVENGSIYRLGTDGIQLYSSGKTQNLSVNVGGRA 240
218699768 161 LLVYPGGEASNCEINQGGVFMLAGKANDTLLAGGTMNNLGGEDSDTIVENGAIYRLGTDGLQLYSSGKTQNLSVNVGGRA 240
82777141  161 LLVYPGGEASNCEINQGGVFMLAGKANDTLLAGGTMNNLGGEDSDTIVENGAIYRLGTDGLQLYSSGKTQNLSVNVGGRA 240
170682120 161 LLVYPGGEASNCEINQGGVFMLAGKANDTLLAGGTMNNLGGEDSDTIVENGAIYRLGTDGLQLYSSGKTQNLSVNVGGRA 240
117623846 161 LLVYPGGEASNCEINQGGVFMLAGKANDTLLAGGTMNNLGGEDSDTIVENGAIYRLGTDGLQLYSSGKTQNLSVNVGGRA 240
15802078  241 EVHAGTLENAVIQGGTVILLSPTSADENFVVEEDRAPVELTGSVALLDGASMIIGYGADLQQSTITVQQGGVLILDGSTV 320
15831627  241 EVHAGTLENAVIQGGTVILLSPTSADENFVVEEDRAPVELTGSVALLDGASMIIGYGADLQQSTITVQQGGVLILDGSTV 320
218558535 241 EVHAGTLENAVIQGGTVILLSPTSADENFVVEEDRAPVELTGSVALLDGASMIIGYGADLQQSTITVQQGGVLILDGSTV 320
91210878  241 EVHAGTLENAVIQGGTVILLSPTSADENFVVEEDRAPVELTGSVALLDGASMIIGYGADLQQSTITVQQGGVLILDGSTV 320
110641787 241 EVHAGTLENAVIQGGTVILLSPTSADENFVVEEDRAPVELTGSVALLDGASMIIGYGADLQQSTITVQQGGVLILDGSTV 320
218689609 241 EVHAGTLENAVIQGGTVILLSPTSADENFVVEEDRAPVELTGSVALLDGASMIIGYGADLQQSTITVQQGGVLILDGSTV 320
218699768 241 EVHAGTLENAVIQGGTVILLSPTSADENFVVEEDRAPVELTGSVALLDGASMIIGYGADLQQSTITVQQGGVLILDGSTV 320
82777141  241 EVHAGTLENAVIQGGTVILLSPTSADENFVVEEDRAPVELTGSVALLDGASMIIGYGADLQQSTITVQQGGVLILDGSTV 320
170682120 241 EVHAGTLENAVIQGGTVILLSPTSADENFVVEEDRAPVELTGSVALLDGASMIIGYGADLQQSTITVQQGGVLILDGSTI 320
117623846 241 EVHAGTLENAVIQGGTVILLSPTSADENFVVEEDRAPVELTGSVALLDGASMIIGYGADLQQSTITVQQGGVLILDGSTV 320
15802078  321 KGDSVTFSIGNINLNGGKLWLITGAATHVQLKVKRLRGEGAICLQTSAKEISPDFINVKGEVNGDIRVQITDASRQTLCN 400
15831627  321 KGDSVTFSIGNINLNGGKLWLITGAATHVQLKVKRLRGEGAICLQTSAKEISPDFINVKGEVNGDIRVQITDASRQTLCN 400
218558535 321 KGDSVTFSVGNINLNGGKLWLITGAATHVQLKVKRLRGEGAICLQTSAKEISPDFINVKGEVTGDIHVEITDASRQTLCN 400
91210878  321 KGDSVTFSVGNINLNGGKLWLITGAATHVQLKVKRLRGEGAICLQTSAKEISPDFINVKGEVTGDIHVEITDASRQTLCN 400
110641787 321 KGDSVTFGIGNINLNGGKLWLITDAATQVQLKVKRLRGEGAICLQTSAKEISPDFINVKGEVTGDIHVEITDASRQTLCN 400
218689609 321 KGDSVTFGIGNINLNGGKLWLITDAATQVQLKVKRLRGEGAICLQTSAKEISPDFINVKGEVTGDIHVEITDASRQTLCN 400
218699768 321 KGDSVTFSVGNINLNGGKLWLITGAATHVQLKVKRLRGEGAICLQTSAKEISPDFINVKGEVTGDIHVEITDASRQTLCN 400
82777141  321 KGDSVTFSIGNSNLNGGKLWLITGAATHVQLKVKRLRGEGAICLQTSAKEISPDFINVKGEVTGDIHVEITDASRQTLCN 400
170682120 321 KGDSVTFSVGNINLNGGKLWLITGAATHVQLKVKRLRGEGAICLQTSAKEISPDFINVKGEVTGDIHVEITDASRQTLCN 400
117623846 321 KGDSVTFSVGNINLNGGKLWLITGAATHVQLKVKRLRGEGAICLQTSAKEISPDFINVKGEVTGDIHVEITDASRQTLCN 400
15802078  401 ALKLQPDEDGIGATLQPA 418
15831627  401 ALKLQPDEDGIGATLQPA 418
218558535 401 ALKLQPDEDGIGATLQPA 418
91210878  401 ALKLQPDEDGIGATLQPA 418
110641787 401 SLKLQPDQDGIGATLQPA 418
218689609 401 SLKLQPDQDGIGATLQPA 418
218699768 401 ALKLQPDEDGIGATLQPA 418
82777141  401 ALKLQPDEDGIGATLQPA 418
170682120 401 ALKLQPDEDGIGATLQPA 418
117623846 401 ALKLQPDEDGIGATLQPA 418
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap