Conserved Protein Domain Family
PRK09891

?
PRK09891: PRK09891 
protein YmcE
Statistics
?
PSSM-Id: 170147
View PSSM: PRK09891
Aligned: 22 rows
Threshold Bit Score: 131.27
Threshold Setting Gi: 260843238
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15800911   1 MHRWISQNNIRLPCGAFFISVLFFFNAVCIVSDNLLIIESFGEMAYNISYLTRVPGTNTLLACCCLLRPEEVNSEY 76 
15830400   1 MHRWISQNNIRLPCGAFFISVLFFFNAVCIVSDNLLIIESFGEMAYNISYLTRVPGTNTLLACCCLLRPEEVNSEY 76 
254792248  1 MHRWISQNNIRLPCGAFFISVLFFFNAVCIVSDNLLIIESFGEMAYNISYLTRVPGTNTLLACCCLLRPEEVNSEY 76 
291281989  1 MHRWISQNNIRLPCGAFFISVLFFFNAVCIVSDNLLIIESFGEMAYNISYLTRVPGTNTLLACCCLLRPEEVNSEY 76 
24112403   1 MRRWISQNNIRLPRGAFFISALFFFNAVCIVSDNLLIIESFGKMAYNISYLTRVPGTNTLLACCCLSRPDEVNSEY 76 
30062529   1 MRRWISQNNIRLPRGAFFISALFFFNAVCIVSDNLLIIESFGKMAYNISYLTRVPGTNTLLACCCLSRPDEVNSEY 76 
82544686   1 MRRWISQNNIRLPRGAFFISALFFFNAVCIVSDNLLIIESFGKMAYNISYLTRVPGTNTLLACCCLSRPDEVNSEY 76 
91210081  12 MRRWISQNNIRLPRGAFFISALFFFNAVCIVSDNLLIIESFGEMAYNISYLTRVPGTNTLLACCCLLRPEEVNSEY 87 
215486107  1 MRRWISQNNIRLPRGAFFISALFFFNAVCIVSDNLLIIESFGEMAYNISYLTRVPGTNTLLACCCLSRPEEVNSEY 76 
260854694  1 MRRWISQNNIRLPRGAFFISALFFFNAVCIVSDNLLIIESFGEMAYNISYLTRVPGTNTLLACCCLSRPEEVNSEY 76 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap