Conserved Protein Domain Family
PRK09823

?
PRK09823: PRK09823 
putative inner membrane protein; Provisional
Statistics
?
PSSM-Id: 170114
View PSSM: PRK09823
Aligned: 35 rows
Threshold Bit Score: 177.755
Threshold Setting Gi: 207855674
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
209921193   1 MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFF------AKEPLVLLRRIQVLPLFLLLSITTGVIPALLTGVMVACLPEK 74 
110807593   1 MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFF------AKEPLVLLVIIQVLPLFLLLSITTGAIPALLTGVMVACLPEK 74 
197248316   1 MSVFRRIIYHSGWFILFGPLIGAAIAIGIINFlpaiigGPDSFLFYFCRTIPELVIITGWIYSLLPAWLTGVACALIPLK 80 
224582004   1 MSVFRRIIYHSGWFILFGPLIGAAIAIGIINFlpaiigGPDSFLFYFCRTIPELVIITGWIYSLLPAWLTGVACALIPLK 80 
62178728    1 MSVFRRIIYHSGWFILFGPLIGAAIAIGIINFlpaiigGPDSFLFYFCRTIPELVIITGWIYSLLPAWLTGVACALIPLK 80 
194446776   1 MSVFRRIIYHSGWFILLGPLIGAATAIGVINYspaiigGPDSFLFCFYRTIPALVIITGWIYSLLPAWLTGVACALIPLK 80 
205351500   1 MSVFRRIIYHSGWFILLGPLIGAATAIGVINYspaiigGPDSFLFCFYRTIPALVIITGWIYSLLPAWLTGVACALIPLK 80 
207855674   1 MSVFRRIIYHSGWFILFGPLIGAAIAIGIINFlpaiigGPDSFLLYFCRTIPELVIITGWIYSLLPAWLTGVACALIPLK 80 
157155421   1 MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFF------AKEPLVLLVIIQVLPLFLLLSITTGAIPALLTCVMVACLPEK 74 
194449525   1 MSVFRRIIYHSGWFILFGPLIGAAIAIGIINFlpaiigGPDSFLLYFCRTIPELVIITGWIYSLLPAWLTGVACALIPLK 80 
209921193  75 IGSQKNYRCLAGGIGGVVITEIYCAVIVHIKGMASSELYENILSGDSLVVRIIPALLAGVVMSRIITRLPGLDISCPETD 154
110807593  75 IGSQKNYRCLAGGIGGVVITEIYCAVIVHIKGMASSELFENILSGDSLVVRIIPALLAGVVMSRIITRLPGLDISCPETD 154
197248316  81 LYQKIINRMILCAIAGGLITTLFNFARYGFDISILPLIYGEVL------IMLIPAIVAGAIMGGVITYLPGLR-EVKRNN 153
224582004  81 LYQKIINRMILCAIAGGLITTLFNFARYGFDISILPLIYGEVL------IMLIPAIVAGAIMGGVITYLPGLR-EVKRNN 153
62178728   81 LYQKIINRMILCAIAGGLITTLFNFARYGFDISILPLIYGEVL------IMLIPAIVAGAIMGGVITYLPGLR-EVKRNN 153
194446776  81 LYQKIINRMILCAIAGGLITTLFNLVRYGFDISILPLIYGEVL------IMLIPAIVAGAIMGGVITYLPGLR-EVKRNN 153
205351500  81 LYQKIINRMILCAIAGGLITTLFNLVRYRFDISILPLIYGEVL------IMLIPAIVAGALMGGVITYLPGLR-EVKRNN 153
207855674  81 LYQKIINRMILCAIAGGLITTLFNLVRYGFDISILPLIYGEVL------IMLIPAIVAGAIMGGVITYLPGLR-EVKRNN 153
157155421  75 IGSQKNYRCLAGGIGGVVITEIYCAVIVHIKGMASSELFENILSGDSLVVRIIPALLAGVVMSRIITRLPGLDISCPETD 154
194449525  81 LYQKIINRMILCAIAGGLITTLFNFARYGFDISILPLIYGEVL------IMLIPAIVAGAIMGGVITYLPGLR-EVKRNN 153
209921193 155 SLS 157
110807593 155 SLS 157
197248316 154 K-- 154
224582004 154 K-- 154
62178728  154 K-- 154
194446776 154 K-- 154
205351500 154 K-- 154
207855674 154 K-- 154
157155421 155 SLS 157
194449525 154 K-- 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap