Conserved Protein Domain Family
PRK09781

?
PRK09781: PRK09781 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 170092
View PSSM: PRK09781
Aligned: 10 rows
Threshold Bit Score: 371.753
Threshold Setting Gi: 194442572
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
205354850   1 MEEVKLYVERVGIDPASGADIRIARRESTSWHKDIVAELINQVLRCGAALIIIAVLTACDDRQVSYFPDYAAIPEQSGIW 80 
207858766   1 MEEVKLYVERVGIDPASGADIRIARRESTSWHKDIVAELINQVLRCGAALIIIAVLTACDDRQVSYFPDYAAIPEQSGIW 80 
16766814    1 MEEVKLYVERVGIDPASGADIRIARRESTSWHKDIVAELINQVLRCGAALIIIAVLTACDDRQVSYFPDYAAIPEQSGIW 80 
161616566   1 MEDVKLYVERVGVDPASGADIRIARRESTSWHKDIVAELINQVLRCGAALIIVAVLTACDDRQVSYFPDYAAIPEQSGIW 80 
197247809   1 MEDVKLYVERVGVDPASGADIRIVRRESTSWHKDIVAELINQVLRCGATLIIIAVLTACDDRQVSYFPDYAAIPEQSGIW 80 
62182028    1 MEDVKLYVERVGVDPASGADIRIARRESTSWHKDIVAELINQVLRCGAALIIVAVLTACDDRQVSYFPDYAAIPEQSGIW 80 
194448800   1 MEEVKLYVERVGIDPASGADIRIARRESTSWHKDIVAELINQVLRCGAALIIIAVLTACDDRQVSYFPDYAAIPEQSGIW 80 
198242177   1 MEEVKLYVERVGIDPASGADIRIARRESTSWHKDIVAELINQVLRCGAALIIIAVLTACDDRQVSYFPDYAAIPEQSGIW 80 
194442572   1 MEDVKLYVERVGVDPISGAGIRIARRESTSWHKDIVAELINQVLRCGAALIIVAVLTACDDRQVSYFPDYAAIPEQSGIW 80 
224585320   1 MEDVKLYVERVGVDPASGADIRIARRESTSWHKDIVAELINQVLRCGAALIIVAVLTACDDRQVSYFPDYAAIPEQSGIW 80 
205354850  81 TWLPVFFPSSASEIEMTFNLDSNLFYADFSVADGDKRAHFESVLGEESVVHYANFSHKSWCKTGKTLWNSEARAKPFFIT 160
207858766  81 TWLPVFFPSSASEIEMTFNLDSNLFYADFSVADGDKRAHFESVLGEESVVHYANFSHKSWCKTGKTLWNSEARAKPFFIT 160
16766814   81 TWLPVFFPSSASEIEMTFNLDSNLFYADFSVADGDKRAHFESVLGEESVVHYANFSHKSWCKTGKTLWNSEARAKPFFIT 160
161616566  81 TWLPVFFPSSASEIEMTFNLDSNLFYADFSVADGDKRAHFESVLGEESVVHYANFTHKSWCKTGKTLWNSEARAKPFFIT 160
197247809  81 TWLPVFFPSSASEIEMTFNLDSNLFYAEFSVADGDKRAHFESVLGEESVVHYANFPHKSWCKTGKTLWNSEARAKPFFIT 160
62182028   81 TWLPVFFPSSASEIEMTFNLDSNLFYADFSVADGDKRAHFESVPGEECVVHYANFTHKSWCKTGKTLWNSEARAKPFFIT 160
194448800  81 TWLPVFFPSSASEIEMTFNLDSNLFYADFSVADGDKRAHFESVLGEESVVHYANFSHKSWCKTGKTLWNSEARAKPFFIT 160
198242177  81 TWLPVFFPSSASEIEMTFNLDSNLFYADFSVADGDKRAHFESVLGEESVVHYANFSHKSWCKTGKTLWNSEARAKPFFIT 160
194442572  81 TWLPVFFPSSASEIEMTFNLDSNLFYADFSVADGDKRAHFESVLGEESVVHYANFSHKSWCKTGKTLWNSEARAKPFFIT 160
224585320  81 TWLPVFFPSSASEIEMTFNLDSNLFYADFSVADGDKRAHFESVLGEECVVHYANFTHKSWCKTGKTLWNSEARAKPFFIT 160
205354850 161 QISVDRYRITNHMPGCTKPGE 181
207858766 161 QISVDRYRITNHMPGCTKPGE 181
16766814  161 QISVDRYRITNHMPGCTKPGE 181
161616566 161 QISVDRYRITNHMPNCTKPGE 181
197247809 161 QISVDRYRITNHMPGCTKPGE 181
62182028  161 QISVDRYRITNHMPGCTKPGE 181
194448800 161 QISVDRYRITNHMPGCTKPGE 181
198242177 161 QISVDRYRITNHMPGCTKPGE 181
194442572 161 KISVDRYRITNHMPGCTKPGE 181
224585320 161 QISVDRYRITNHMPGCTKPGE 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap