Conserved Protein Domain Family
PRK09778

?
PRK09778: PRK09778 
type I toxin-antitoxin system antitoxin YafN
Statistics
?
PSSM-Id: 170091
View PSSM: PRK09778
Aligned: 24 rows
Threshold Bit Score: 149.735
Threshold Setting Gi: 56461625
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15799937   1 MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA 80 
238899622  1 MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA 80 
91209320   1 MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA 80 
110640468  1 MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA 80 
117622534  1 MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA 80 
24111722   1 MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA 80 
30061849   1 MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA 80 
110804357  1 MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA 80 
170683148  1 MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA 80 
218688124  1 MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA 80 
15799937  81 EKYLNDMTDDDFNDFKE 97 
238899622 81 EQYLNDMTDDDFNDFKE 97 
91209320  81 EQYLNDMTDDDFNDFKE 97 
110640468 81 EQYLNDMTDDDFNDFKE 97 
117622534 81 EQYLNDMTDDDFNDFKE 97 
24111722  81 KQYLNDMTDDDFNDFKE 97 
30061849  81 KQYLNDMTDDDFNDFKE 97 
110804357 81 KQYLNDMTDDDFNDFKE 97 
170683148 81 EQYLNDMTDDDFNDFKE 97 
218688124 81 EQYLNDMTDDDFNDFKE 97 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap