Conserved Protein Domain Family
PRK09772

?
PRK09772: PRK09772 
transcriptional antiterminator BglG; Provisional
Statistics
?
PSSM-Id: 170086
View PSSM: PRK09772
Aligned: 25 rows
Threshold Bit Score: 506.551
Threshold Setting Gi: 24114961
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
117625996   1 MNMQITKILNNNVVVVIDDQQREKVVMGRGIGFQKRPGERINSSGIEKEYALSSHELNGRLSELLSHMPLEVMATCDRII 80 
253775642   1 MNMQITKILNNNVVVVIDDQQREKVVMGRGIGFQKRPGERINSSGIEKEYALSSHELNGRLSELLSHIPLEVMATCDRII 80 
254163675   1 MNMQITKILNNNVVVVIDDQQREKVVMGRGIGFQKRPGERINSSGIEKEYALSSHELNGRLSELLSHIPLEVMATCDRII 80 
218560798   1 MNMQITKILNNNVVVVIDDQQREKVVMGRGIGFQKRPGERINSSGIEKEYALSSHELNGRLSELLSHMPLEVMATCDRII 80 
215489061   1 MNMQITKILNNNVVVVIDDQQREKVVMGRGIGFQKRPGERINSSGIEKEYALSSHELNGRLSELLSHMPLEVMATCDRII 80 
260846492   1 MNMQITKILNNNVVVVIDDQQREKVVMGRGIGFQKRAGERINSSGIEKEYALSSHELNGRLSELLSHIPLEVMATCDRII 80 
218692011   1 MNMQITKILNNNVVVVIDDQQREKVVMGRGIGFQKRPSERINSSGIEKEYALSSHELNGRLSELLSHMPLEVMATCDRII 80 
26250464    9 MNMQITKILNNNVVVVIDDQQREKVVMGRGIGFQKRPGERINSSGIEKEYALSSHELNGRLSELLSHMPLEVMATCDRII 88 
110644064   1 MNMQITKILNNNVVVVIDDQQREKVVMGRGIGFQKRPGERINSSGIEKEYALSSHELNGRLSELLSHMPLEVMATCDRII 80 
218551256   1 MNMQITKILNNNVVVVIDDQQREKVVMGRGIGFQKRPGERINSSGIEKEYALSSHELNGRLSELLSHMPIEVMATCDRII 80 
117625996  81 SLAQERLGKLQDSIYISLTDHCQFAIKRFQQNVLLPNPLLWDIQRLYPKEFQLGEEALTIIDKRLGVQLPKDEVGFIAMH 160
253775642  81 SLAQERLGKLQDSIYISLTDHCQFAIKRFQQNVLLPNPLLWDIQRLYPKEFQLGEEALAIIDKRLGVQLPKDEVGFIAMH 160
254163675  81 SLAQERLGKLQDSIYISLTDHCQFAIKRFQQNVLLPNPLLWDIQRLYPKEFQLGEEALAIIDKRLGVQLPKDEVGFIAMH 160
218560798  81 SLAQERLGKLQDSIYISLTDHCQFAIKRFQQNVLLPNPLLWDIQRLYPKEFQLGEEALTIIDKRLGVQLPKDEVGFIAMH 160
215489061  81 SLAQERQGKLQDSIYISLTDHCQFAIKRFQQNVLLPNPLLWDIQRLYPKEFQLGEEALTIIDKRLGVQLPKDEVGFIAMH 160
260846492  81 SLAQERLGKLQDSIYISLTDHCQFAIKRFQQNVLLPNPLLWDIQRLYPKEFQLGEEALTIIDKRLGVQLPKDEVGFIAMH 160
218692011  81 SLAQERLGKLQDSIYISLTDHCQFAIKRFQQNVLLPNPLLWDIQRLYPKEFQLGEEALTIIDKRLGVQLPKDEVGFIAMH 160
26250464   89 SLAQERLGKLQDSIYISLTDHCQFAIKRFQQNVLLPNPLLWDIQRLYPKEFQLGEEALTIIDKRLGVQLPKDEVGFIAMH 168
110644064  81 SLAQERLGKLQDSIYISLTDHCQFAIKRFQQNVLLPNPLLWDIQRLYPKEFQLGEEALTIIDKRLGVQLPKDEVGFIAMH 160
218551256  81 SLAQERLGKLQDSIYISLTDHCQFAIKRFQQNVLLPNPLLWDIQRLYPKEFQLGEEALTIIDKRLGVQLPKDEVGFIAMH 160
117625996 161 LVSAQMSGNMEDVAGVTQLMREMLQLIKFQFSLNYQEESLSYQRLVTHLKFLSWRILEHASINDSDESLQQAVKQNYPQA 240
253775642 161 LVSAQMSGNMEDVAGVTQLMREMLQLIKFQFSLNYQEESLSYQRLVTHLKFLSWRILEHASINDSDESLQQAVKQNYPQA 240
254163675 161 LVSAQMSGNMEDVAGVTQLMREMLQLIKFQFSLNYQEESLSYQRLVTHLKFLSWRILEHASINDSDESLQQAVKQNYPQA 240
218560798 161 LVSAQMSGNMEDVAGVTQLMREMLQLIKFQFSLNYQEESLSYQRLVTHLKFLSWRILEHASINDSDESLQQAVKQNYPQA 240
215489061 161 LVSAQMSGNMEDVAGVTQLMREMLQLIKFQFSLNYQEESLSYQRLVTHLKFLSWRIIEHASINDSDESLQQAVKQNYQQA 240
260846492 161 LVSAQMSGNMEDVAGVTQLMREMLQLIKFQFSLNYQEESLSYQRLVTHLKFLSWRILGHASINDSDESLQQAVKQNYPQA 240
218692011 161 LVSAQMSGNMEDVAGVTQLMREMLQLIKFQFSLNYQEESLSYQRLVTHLKFLSWRILEHASINDSDESLQQAVKQNYPQA 240
26250464  169 LVSAQMSGNMEDVAGVTQLMREMLQLIKFQFSLNYQEESLSYQRLVTHLKFLSWRIIEHASINDSDESLQQAVKQNYPQA 248
110644064 161 LVSAQMSGNMEDVAGVTQLMREMLQLIKFQFSLNYQEESLSYQRLVTHLKFLSWRILEHASINDSDESLQQAVKQNYQQA 240
218551256 161 LVSAQMSGNMEDVAGVTQLMREILQLIKFQFSLNYQEESLSYQRLVTHLKFLSWRILEHASINDSDESLQQAVKQNYPQA 240
117625996 241 WQCAERIAIFIGLQYQRKISPAEIMFLAINIERVRKEH 278
253775642 241 WQCAERIAIFIGLQYQRKISPAEIMFLAINIERVRKEH 278
254163675 241 WQCAERIAIFIGLQYQRKISPAEIMFLAINIERVRKEH 278
218560798 241 WQCAERIAIFIGLQYQRKISPAEIMFLAINIERVRKEH 278
215489061 241 WQCAERIAIFIGLQYQRKISPAEIMFLAINIERVRKEH 278
260846492 241 WQCAERIAIFIGLQYQRKISPAEIMFLAINIERVRKEH 278
218692011 241 WQCAERIAIFIGLQYQRKISPAEIMFLAINIERVRKEH 278
26250464  249 WQCAERIAIFIGLQYQRKISPAEIMFLAINIERVRKEH 286
110644064 241 WQCAERIAIFIGLQYQRKISPAEIMFLAINIERVRKEH 278
218551256 241 WQCAERIAIFIGLQYQRKISPAEIMFLAINIERVRKEH 278
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap