Conserved Protein Domain Family
PRK09754

?
PRK09754: PRK09754 
phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional
Statistics
?
PSSM-Id: 170080
View PSSM: PRK09754
Aligned: 25 rows
Threshold Bit Score: 704.763
Threshold Setting Gi: 253989832
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
37526123    1 MRNQTFIIVGAGQAGAMAAATLRQQQFDGDIILIGKEYHAPYERPILSKDYLINPEEAPKYLFSEDFYLEKQIDLRIGQL 80 
15803068    1 MKEKTIIIVGGGQAAAMAAASLRQQGFTGELHLFSDEQHLPYERPPLSKSMLLEDSPQLQSVLPAHWWQENNVHLHSGVT 80 
15832662    1 MKEKTIIIVGGGQAAAMAAASLRQQGFTGELHLFSDEQHLPYERPPLSKSMLLEDSPQLQSVLPAHWWQENNVHLHSGVT 80 
209399212   1 MKEKTIIIVGGGQAAAMAAASLRQQGFTGELHLFSDEQHLPYERPPLSKSMLLEDSPQLQSVLPAHWWQENNVHLHSGVT 80 
254794492   1 MKEKTIIIVGGGQAAAMAAASLRQQGFTGELHLFSDEQHLPYERPPLSKSMLLEDSPQLQSVLPAHWWQENNVHLHSGVT 80 
254162516   1 MKEKTIIIVGGGQAAAMAAASLRQQGFTGELHLFSDERHLPYERPPLSKSMLLEDSPQLQQVLPANWWQENNVHLHSGVT 80 
110806473   1 MKEKTIIIVGGGQAAAMAAASLRQQGFTGELHLFSDERHLPYERPPLSKSMLLEDSPQLQQVLPANWWQENNVHLHSGVT 80 
218706045   1 MKEKTIIIVGGGQAAAMAAASLRQQGFTGELHLFSDERHLPYERPPLSKSMLLEDSPQLQQVLPANWWQENNVHLHSGVT 80 
170683500   1 MKEKTIIIVGGGQAAAMAAASLRQQGFTGELHLFSDEQHLPYERPPLSKSMLLEDSPQLQSVLPAHWWQENNVHLHSGVT 80 
291283767   1 MKEKTIIIVGGGQAAAMAAASLRQQGFTGELHLFSDEQHLPYERPPLSKSMLLEDSPQLQSVLPAHWWQENNVHLHSGVT 80 
37526123   81 VSQIMPSKHCVVLENGGKLRYDKLLLTMGARARRFPLLDQLGENIYTLRTLDDAQRLRQAVKKDKRILIVGGGVIGLELA 160
15803068   81 IKTLGRDTRELVLANGESWHWDQLFIATGAAARPLPLLDALGERCFTLRHAGDAARLREVLQPERSVVIVGAGTIGLELA 160
15832662   81 IKTLGRDTRELVLANGESWHWDQLFIATGAAARPLPLLDALGERCFTLRHAGDAARLREVLQPERSVVIVGAGTIGLELA 160
209399212  81 IKTLGRDTRELVLANGESWHWDQLFIATGAAARPLPLLDALGERCFTLRHAGDAARLREVLQPERSVVIVGAGTIGLELA 160
254794492  81 IKTLGRDTRELVLANGESWHWDQLFIATGAAARPLPLLDALGERCFTLRHAGDAARLREVLQPERSVVIVGAGTIGLELA 160
254162516  81 IKTLGRDTRELVLTNGESWHWDQLFIATGAAARPLPLLDALGERCFTLRHAGDAARLREVLQPERSVVIIGAGTIGLELA 160
110806473  81 IKTLGRDTRELVLTNGESWHWDQLFIATGAAARPLPLLDALGERCFTLHHAGDAARLREVLQPERSVVIVGAGTIGLELA 160
218706045  81 IKSLGRDTRELVLTNGESWQWDQLFMATGAAARPLPLLDALGERCFTLRHADDAARLREVLQPERSVVIVGAGTIGLELA 160
170683500  81 IKTLGRDTRELVLANGESWHWDQLFIATGAAARPLPLLDALGERCFTLRHAGDAARLREVLQPERSVVIVGAGTIGLELA 160
291283767  81 IKTLSRDTRELVLANGESWHWDQLFIATGAAARPLPLLDALGERCFTLRHAGDAARLREVLQPERSVVIVGAGTIGLELA 160
37526123  161 ATSC----------ELGANVTVIEQADNIMGRCAPPLLQDYLLNRHQEKGVQFFLDTNIVSAQKqGSELVLILNTGEKVI 230
15803068  161 ASAT----------QRRCKVTVIELAATVMGRNAPPPVQRYLLQRHQQAGVRILLNNAIEHVVD-GEKVELTLQSGETLQ 229
15832662  161 ASAT----------QRRCKVTVIELAATVMGRNAPPPVQRYLLQRHQQAGVRILLNNAIEHVVD-GEKVELTLQSGETLQ 229
209399212 161 ASAT----------QRRCKVTVIELAATVMGRNAPPPVQRYLLQRHQQAGVRILLNNAIEHVVD-GEKVELTLQSGETLQ 229
254794492 161 ASAT----------QRRCKVTVIELAATVMGRNAPPPVQRYLLQRHQQAGVRILLNNAIEHVVD-GEKVELTLQSGETLQ 229
254162516 161 ASAT----------QRRCKVTVIELAATVMGRNAPPPVQRYLLQRHQQAGVRILLNNAIEHVVD-GEKVELTLQSGETLQ 229
110806473 161 ASATqrsaaqrsaaQRRCKVTVIELAATVMGRNAPPPVQRYLLQRHQQAGVRILLNNAIEHVVD-GEKVELTLQSGETLQ 239
218706045 161 ASAT----------QRGCKVTVIELAATVMGRNAPPPVQRYLLQRHQQAGVRILLNNAIEHVVD-GEKVELTLQSGETLQ 229
170683500 161 ASAT----------QRGCKVTVIELAATVMGRNAPPPVQHYLLQRHQQAGVRILLNNAIEHVVD-GENVELTLQSGETLR 229
291283767 161 ASAT----------QRRCKVTVIELAATVMGRNAPPPVQRYLLQRHQQAGVRILLNNAIEHVVD-GEKVELTLQSGETLQ 229
37526123  231 GDIIIYGIGAEFRDQLAADAGLVTDGGIVIDSRCQTSEPDIFAAGDVCLQREPlTGDLQRRETWENANRQATIAAHAMMG 310
15803068  230 ADVVIYGIGISANDQLAREANLDTTNGIVIDEACRTCDPAIFAGGDVAITRLD-NGALHRCESWENANNHAQIAAAAMLG 308
15832662  230 ADVVIYGIGISANDQLAREANLDTTNGIVIDEACRTCDPAIFAGGDVAITRLD-NGALHRCESWENANNHAQIAAAAMLG 308
209399212 230 ADVVIYGIGISANDQLAREANLDTTNGIVIDEACRTCDPAIFAGGDVAITRLD-NGALHRCESWENANNHAQIAAAAMLG 308
254794492 230 ADVVIYGIGISANDQLAREANLDTTNGIVIDEACRTCDPAIFAGGDVAITRLD-NGALHRCESWENANNHAQIAAAAMLG 308
254162516 230 ADVVIYGIGISANEQLAREANLDTANGIVIDEACRTCDPAIFAGGDVAITRLD-NGALHRCESWENANNQAQIAAAAMLG 308
110806473 240 ADVVIYGIGISANEQLAREANLDTANGIVIDEACRTCDPAIFAGGDVAITRLD-NGALHRCESWENANNQAQIAAAAMLG 318
218706045 230 ADVVIYGIGISANDQLAREANLDTANGIVIDEACRTCDPAIFAGGDVAITRLD-NGALHRCESWENANNQAQIAAAAMLG 308
170683500 230 ADVVIYGIGISANDQLAREANLDTANGIVIDEACRTCDPAIFAGGDVAITRLD-NGALHRCESWENANNQAQIAASAMLG 308
291283767 230 ADVVIYGIGISANDQLAREANLDTTNGIVIDEACRTCDPAIFAGGDVAITRLD-NGALHRCESWENANNHAQIAAAAMLG 308
37526123  311 LAPPQPGAPWFWTDQWGINIQMVGNMQAEEWHIQGDLQSDKAILFGTENEVLVGAVAINQGREMRNLRKLLAN----PAQ 386
15803068  309 LPLPLLPPPWFWSDQYSDNLQFIGDMRGDDWLCRGNPETQKAIWFNLQNGVLIGAVTLNQGREIRSIRKWIQSgktfDAK 388
15832662  309 LPLPLLPPPWFWSDQYSDNLQFIGDMRGDDWLCRGNPETQKAIWFNLQNGVLIGAVTLNQGREIRSIRKWIQSgktfDAK 388
209399212 309 LPLPLLPPPWFWSDQYSDNLQFIGDMRGDDWLCRGNPETQKAIWFNLQNGVLIGAVTLNQGREIRSIRKWIQSgktfDAK 388
254794492 309 LPLPLLPPPWFWSDQYSDNLQFIGDMRGDDWLCRGNPETQKAIWFNLQNGVLIGAVTLNQGREIRSIRKWIQSgktfDAK 388
254162516 309 LPLPLLPPPWFWSDQYSDNLQFIGDMRGDDWLCRGNPETQKAIWFNLQNGVLIGAVTLNQGREIRPIRKWIQSgktfDAK 388
110806473 319 LPLPLLPPPWFWSDQYSDNLQFIGDMRGDDWLCRGNPETQKAIWFNLQNGVLIGAVTLNQGREIRPIRKWIQSgktfDAK 398
218706045 309 LPLPRLPPPWFWSDQYSDNLQFIGDMHGDDWICRGNPETQKAIWFNLQNGVLIGAVTLNQGREIRPIRKWIQSgktfNAK 388
170683500 309 LPLPRLPPPWFWSDQYSDNLQFIGDMHGDDWLCRGNPETQKAIWFNLQNGVLIGAVTLNQGREIRPIRKWIQSgktfDAK 388
291283767 309 LPLPLLPPPWFWSDQYSDNLQFIGDMRGDDWLCRGNPETQKAIWFNLQNGVLIGAVTLNQGREIRSIRKWIQSgktfDAK 388
37526123  387 VVSGVEWA 394
15803068  389 QLTDENIA 396
15832662  389 QLTDENIA 396
209399212 389 QLTDENIA 396
254794492 389 QLTDENIA 396
254162516 389 LLIDENIA 396
110806473 399 LLIDENIA 406
218706045 389 LLTDEDIA 396
170683500 389 LLTDEDIA 396
291283767 389 QLTDENIA 396
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap