Conserved Protein Domain Family
PRK09751

?
PRK09751: PRK09751 
putative ATP-dependent helicase Lhr; Provisional
Statistics
?
PSSM-Id: 137505
View PSSM: PRK09751
Aligned: 24 rows
Threshold Bit Score: 2626.52
Threshold Setting Gi: 162148456
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
162148456    1 MIAPTGSGKTLAAFLHAIDRLFREReaeavagtAAESTTPGPGAATRVLYISPIKALGADVQRNLRIPLHGVGAERKRRG 80  
15802067    49 VIAPTGSGKTLAAFLYALDRLFREG--------GEDTREAHKRKTSRILYISPIKALGTDVQRNLQIPLKGIADERRRRG 120 
15831616    49 VIAPTGSGKTLAAFLYALDRLFREG--------GEDTREAHKRKTSRILYISPIKALGTDVQRNLQIPLKGIADERRRRG 120 
209398820   49 VIAPTGSGKTLAAFLYALDRLFREG--------GEDTREAHKRKTSRILYISPIKALGTDVQRNLQIPLKGIADERRRRG 120 
254793270   49 VIAPTGSGKTLAAFLYALDRLFREG--------GEDTREAHKRKTSRILYISPIKALGTDVQRNLQIPLKGIADERRRRG 120 
253773388   49 VIAPTGSGKTLAAFLYALDRLFREG--------GEDTREAHKRKTSRILYISPIKALGTDVQRNLQIPLKGIADERRRRG 120 
254161715   49 VIAPTGSGKTLAAFLYALDRLFREG--------GEDTREAHKRKTSRILYISPIKALGTDVQRNLQIPLKGIADERRRRG 120 
218699779   49 VIAPTGSGKTLAAFLYALDQLFREG--------GEDTREAHKRKTSRILYISPLKALGTDVQRNLQIPLQGIADERRRRG 120 
218705153   49 VIAPTGSGKTLAAFLYALDQLFREG--------GEDTREAHKRKTSRILYISPIKALGTDVQRNLQIPLQGIADERRRRG 120 
291282785   49 VIAPTGSGKTLAAFLYALDRLFREG--------GEDTREAHKRKTSRILYISPIKALGTDVQRNLQIPLKSIADERRRRG 120 
162148456   81 DLAVEITVGMRTGDTPSAERAGLLRRPPDILITTPESLYLMLTSKARETLRGVHAVIVDEVHAVAGTKRGAHLALSLERL 160 
15802067   121 ETEVNLRVGIRTGDTPAQERSKLTRNPPDILITTPESLYLMLTSRARETLRGVETVIIDEVHAVAGSKRGAHLALSLERL 200 
15831616   121 ETEVNLRVGIRTGDTPAQERSKLTRNPPDILITTPESLYLMLTSRARETLRGVETVIIDEVHAVAGSKRGAHLALSLERL 200 
209398820  121 ETEVNLRVGIRTGDTPAQERSKLTRNPPDILITTPESLYLMLTSRARETLRGVETVIIDEVHAVAGSKRGAHLALSLERL 200 
254793270  121 ETEVNLRVGIRTGDTPAQERSKLTRNPPDILITTPESLYLMLTSRARETLRGVETVIIDEVHAVAGSKRGAHLALSLERL 200 
253773388  121 ETEVNLRVGIRTGDTPAQERSKLTRNPPDILITTPESLYLMLTSRARETLRGVETVIIDEVHAVAGSKRGAHLALSLERL 200 
254161715  121 ETEVNLRVGIRTGDTPAQERSKLTRNPPDILITTPESLYLMLTSRARETLRGVETVIIDEVHAVAGSKRGAHLALSLERL 200 
218699779  121 ETEVNLRVGIRTGDTPAQERSKLTRNPPDILITTPESLYLMLTSRARETLRGVETVIIDEVHAVAGSKRGAHLALSLERL 200 
218705153  121 ETEVNLRVGIRTGDTPAQERSKLTRNPPDILITTPESLYLMLTSRARETLRGVETVIIDEVHAVAGSKRGAHLALSLERL 200 
291282785  121 ETEVNLRVGIRTGDTPAQERSKLTRNPPDILITTPESLYLMLTSRARETLRGVETVIIDEVHAVAGSKRGAHLALSLERL 200 
162148456  161 DALLPTRAQRIGLSATVRPADRVALFLGGARPVTIVNPPSSRRLDLKIVVPVADMSDLAASGGQPGDGERSTRAGSIWPH 240 
15802067   201 DALLHTSAQRIGLSATVRSASDVAAFLGGDRPVTVVNPPAMRHPQIRIVVPVANMDDVSSVASGTGEDSHAGREGSIWPY 280 
15831616   201 DALLHTSAQRIGLSATVRSASDVAAFLGGDRPVTVVNPPAMRHPQIRIVVPVANMDDVSSVASGTGEDSHAGREGSIWPY 280 
209398820  201 DALLHTSAQRIGLSATVRSASDVAAFLGGDRPVTVVNPPAMRHPQIRIVVPVANMDDVSSVASGTGEDSHAGREGSIWPY 280 
254793270  201 DALLHTSAQRIGLSATVRSASDVAAFLGGDRPVTVVNPPAMRHPQIRIVVPVANMDDVSSVASGTGEDSHAGREGSIWPY 280 
253773388  201 DALLHTSAQRIGLSATVRSASDVAAFLGGDRPVTVVNPPAMRHPQIRIVVPVANMDDVSSVASGTGEDSHAGREGSIWPY 280 
254161715  201 DALLHTSAQRIGLSATVRSASDVAAFLGGDRPVTVVNPPAMRHPQIRIVVPVANMDDVSSVASGTGEDSHAGREGSIWPY 280 
218699779  201 DALLHTSAQRIGLSATVRSASDVAAFLGGDRPVTVVNPPAMRHPQIRIVVPVANMDDVSSVASGTGEDSHAGREGSIWPY 280 
218705153  201 DALLHTSAQRIGLSATVRSASDVAAFLGGDRPVTVVNPPAMRHPQIRIVVPVANMDDVSSVASGTGEDSHAGREGSIWPY 280 
291282785  201 DALLHTSAQRIGLSATVRSASDVAAFLGGDRPVTVVNPPAMRHPQIRIVVPVANMDDVSSVASGTGEDSHAGREGSIWPY 280 
162148456  241 VEASILDRILPRRATIVFTNSRGLAEKLTARLNELYAERFAQDMPDPEPTAHYASVSGSTEKRSTGAPPLLARSHHGSVS 320 
15802067   281 IETGILDEVLRHRSTIVFTNSRGLAEKLTARLNELYAARLQRSPSIAADAAHFESTSGATSNRVQSSDVFIARSHHGSVS 360 
15831616   281 IETGILDEVLRHRSTIVFTNSRGLAEKLTARLNELYAARLQRSPSIAADAAHFESTSGATSNRVQSSDVFIARSHHGSVS 360 
209398820  281 IETGILDEVLRHRSTIVFTNSRGLAEKLTARLNELYAARLQRSPSIAADAAHFESTSGATSNRVQSSDVFIARSHHGSVS 360 
254793270  281 IETGILDEVLRHRSTIVFTNSRGLAEKLTARLNELYAARLQRSPSIAADAAHFESTSGATSNRVQSSDVFIARSHHGSVS 360 
253773388  281 IETGILDEVLRHRSTIVFTNSRGLAEKLTARLNELYAARLQRSPSIAVDAAHFESTSGATSNRVQSSDVFIARSHHGSVS 360 
254161715  281 IETGILDEVLRHRSTIVFTNSRGLAEKLTARLNELYAARLQRSPSIAVDAAHFESTSGATSNRVQSSDVFIARSHHGSVS 360 
218699779  281 IETGILDEVLRHRSTIIFTNSRGLAEKLTARLNELYAARLQRSPSIAVDAAHFESTSGATSNRVQSSDIFIARSHHGSVS 360 
218705153  281 IETGILDEVLRHRSTIVFTNSRGLAEKLTARLNELYAARLQRSPSIAVDAAHFESTSGATSNRVQSSDIFIARSHHGSVS 360 
291282785  281 IETGILDEVLRHRSTIVFTNSRGLAEKLTARLNELYAARLQRSPSIAADAAHFESTSGATSNRVQSSDVFIARSHHGSVS 360 
162148456  321 KEQRREIESALKSGELRCVVATSSLELGIDMGLVDLVIQVAAPPSVASGLQRVGRAGHQVGGASSGLVYPRTRRDLVDAT 400 
15802067   361 KEQRAITEQALKSGELRCVVATSSLELGIDMGAVELVIQVATPLSVASGLQRIGRAGHQIGGISKGLFFPRTRRDLVDSA 440 
15831616   361 KEQRAITEQALKSGELRCVVATSSLELGIDMGAVELVIQVATPLSVASGLQRIGRAGHQIGGISKGLFFPRTRRDLVDSA 440 
209398820  361 KEQRAITEQALKSGELRCVVATSSLELGIDMGAVELVIQVATPLSVASGLQRIGRAGHQIGGISKGLFFPRTRRDLVDSA 440 
254793270  361 KEQRAITEQALKSGELRCVVATSSLELGIDMGAVELVIQVATPLSVASGLQRIGRAGHQIGGISKGLFFPRTRRDLVDSA 440 
253773388  361 KEQRAITEQALKSGELRCVVATSSLELGIDMGAVDLVIQVATPLSVASGLQRIGRAGHQVGGVSKGLFFPRTRRDLVDSA 440 
254161715  361 KEQRAITEQALKSGELRCVVATSSLELGIDMGAVDLVIQVATPLSVASGLQRIGRAGHQVGGVSKGLFFPRTRRDLVDSA 440 
218699779  361 KEQRAITEQALKSGELRCVVATSSLELGIDMGAVDLVIQVATPLSVASGLQRIGRAGHQVGGVSKGLFFPRTRRDLVDSA 440 
218705153  361 KEQRAITEQALKSGELRCVVATSSLELGIDMGAVDLVIQVATPLSVASGLQRIGRAGHQVGGISKGLFFPRTRRDLVDSA 440 
291282785  361 KEQRAITEQALKSGELRCVVATSSLELGIDMGAVELVIQVATPLSVASGLQRIGRAGHQVGGISKGLFFPRTRRDLVDSA 440 
162148456  401 VTVESMLAGRIETLDPPRNPLDVLAQQTVAAVAVSPLAVEDWYATVRRAAPFRTLPRAAFDATLDMLAGRYPSDDFAAFR 480 
15802067   441 VIVECMFAGRLENLTPPHNPLDVLAQHTVAAAAMDALQVDEWYSRVRRAAPWKDLPRRVFDATLDMLSGRYPSGDFSAFR 520 
15831616   441 VIVECMFAGRLENLTPPHNPLDVLAQHTVAAAAMDALQVDEWYSRVRRAAPWKDLPRRVFDATLDMLSGRYPSGDFSAFR 520 
209398820  441 VIVECMFAGRLENLTPPHNPLDVLAQHTVAAAAMDALQVDEWYSRVRRAAPWKDLPRRVFDATLDMLSGRYPSGDFSAFR 520 
254793270  441 VIVECMFAGRLENLTPPHNPLDVLAQHTVAAAAMDALQVDEWYSRVRRAAPWKDLPRRVFDATLDMLSGRYPSGDFSAFR 520 
253773388  441 VIVECMFAGRLENLTPPHNPLDVLAQQTVAAAAMDALQVDEWYSRVRRAAPWKDLPRRVFDATLDMLSGRYPSGDFSAFR 520 
254161715  441 VIVECMFAGRLENLTPPHNPLDVLAQQTVAAAAMDALQVDEWYSRVRRAAPWKDLPRRVFDATLDMLSGRYPSGDFSAFR 520 
218699779  441 VIVECMFAGRLENLTPPHNPLDVLAQQTVAAAAMEALQVDEWYSRVRRAAPWKDLPGRVFDATLDMLSGRYPSGDFSAFR 520 
218705153  441 VIVECMFAGRLENLTPPHNPLDVLAQQTVAAAAMDALQVDEWYSRVRRAAPWKDLPRRVFDATLDMLSGRYPSGDFSAFR 520 
291282785  441 VIVECMFAGRLENLTPPHNPLDVLAQHTVAAAAMDALQVDEWYSRVRRAAPWKDLPRRVFDATLDMLSGRYPSGDFSAFR 520 
162148456  481 PRLVWHRETGLLTPRPGALQLAVTSGGTIPDRGLFTVVLPEGEERAGSRRVGELDEEMVYESRVNDIITLGTTSWRIEQI 560 
15802067   521 PKLVWNRETGILTARPGAQLLAVTSGGTIPDRGMYSVLLPEGEEQAGSRRVGELDEEMVYESRVNDIITLGATSWRIQQI 600 
15831616   521 PKLVWNRETGILTARPGAQLLAVTSGGTIPDRGMYSVLLPEGEEQAGSRRVGELDEEMVYESRVNDIITLGATSWRIQQI 600 
209398820  521 PKLVWNRETGILTARPGAQLLAVTSGGTIPDRGMYSVLLPEGEEQAGSRRVGELDEEMVYESRVNDIITLGATSWRIQQI 600 
254793270  521 PKLVWNRETGILTARPGAQLLAVTSGGTIPDRGMYSVLLPEGEEQAGSRRVGELDEEMVYESRVNDIITLGATSWRIQQI 600 
253773388  521 PKLVWNRETGILTARPGAQLLAVTSGGTIPDRGMYSVLLPEGEEKAGSRRVGELDEEMVYESRVNDIITLGATSWRIQQI 600 
254161715  521 PKLVWNRETGILTARPGAQLLAVTSGGTIPDRGMYSVLLPEGEEKAGSRRVGELDEEMVYESRVNDIITLGATSWRIQQI 600 
218699779  521 PKLVWNRETGILTARPGAQLLAVTSGGTIPDRGMYSVLLPEGEEQAGSRRVGELDEEMVYESRVNDIITLGATSWRIQQI 600 
218705153  521 PKLVWNRETGILTARPGAQLLAVTSGGTIPDRGMYSVLLPEGEEQAGSRRVGELDEEMVYESRVNDIITLGATSWRIQQI 600 
291282785  521 PKLVWNRETGILTARPGAQLLAVTSGGTIPDRGMYSVLLPEGEEQAGSRRVGELDEEMVYESRVNDIITLGATSWRIQQI 600 
162148456  561 TNDQVIVTPAPGRSARLPFWHGDGVRRPAELGEAIGAFLAALDTGPREEAGDGAPLPgpetrlraaglDPNAITNILALI 640 
15802067   601 TRDQVIVTPAPGRSARLPFWRGEGNGRPAELGEMIGDFLHLLADGAFFSGTIPPWLA-----------EENTIANIQGLI 669 
15831616   601 TRDQVIVTPAPGRSARLPFWRGEGNGRPAELGEMIGDFLHLLADGAFFSGTIPPWLA-----------EENTIANIQGLI 669 
209398820  601 TRDQVIVTPAPGRSARLPFWRGEGNGRPAELGEMIGDFLHLLADGAFFSGTIPPWLA-----------EENTIANIQGLI 669 
254793270  601 TRDQVIVTPAPGRSARLPFWRGEGNGRPAELGEMIGDFLHLLADGAFFSGTIPPWLA-----------EENTIANIQGLI 669 
253773388  601 TRDQVIVTPAPGRSARLPFWRGEGNGRPAELGEMIGDFLHLLADGAFFSGTIPPWLA-----------EENTIANIQGLI 669 
254161715  601 TRDQVIVTPAPGRSARLPFWRGEGNGRPAELGEMIGDFLHLLADGAFFSGTIPPWLA-----------EENTIANIQGLI 669 
218699779  601 TRDQVIVTPAPGRSARLPFWRGEGNGRPAELGEMIGDFLHLLADGAFFSGTIPPWLA-----------EENTIANIQGLI 669 
218705153  601 TRDQVIVTPAPGRSARLPFWRGEGNGRPAELGEMIGDFLHLLADGAFFSGTIPPWLA-----------EENTIANIQGLI 669 
291282785  601 TRDQVIVTPAPGRSARLPFWRGEGNGRPAELGEMIGDFLHLLADGAFFSGTIPPWLA-----------EENTIANIQGLI 669 
162148456  641 DTQRTATGVLPTDRTLVVERCRDETGDWRVILHSPYGRRVHDPWALAIAARVQRRFGIDPSVVASDDGIVARLPDTAGRL 720 
15802067   670 DEQRNATGIVPGSRHLVLERCRDEIGDWRIILHSPYGRRVHEPWALAIAGRIHALWGADASVVASDDGIVARIPDTDGKL 749 
15831616   670 DEQRNATGIVPGSRHLVLERCRDEIGDWRIILHSPYGRRVHEPWALAIAGRIHALWGADASVVASDDGIVARIPDTDGKL 749 
209398820  670 DEQRNATGIVPGSRHLVLERCRDEIGDWRIILHSPYGRRVHEPWALAIAGRIHALWGADASVVASDDGIVARIPDTDGKL 749 
254793270  670 DEQRNATGIVPGSRHLVLERCRDEIGDWRIILHSPYGRRVHEPWALAIAGRIHALWGADASVVASDDGIVARIPDTDGKL 749 
253773388  670 EEQRNATGIVPGSRHLVLERCRDEIGDWRIILHSPYGRRVHEPWALAIAGRIHALWGADASVVASDDGIVARIPDTDGKL 749 
254161715  670 EEQRNATGIVPGSRHLVLERCRDEIGDWRIILHSPYGRRVHEPWALAIAGRIHALWGADASVVASDDGIVARIPDTDGKL 749 
218699779  670 DEQRNATGIVPGSRHLVLERCRDEIGDWRIILHSPYGRRVHEPWALAIAGRIHALWGADASVVASDDGIVARIPDTDGKL 749 
218705153  670 DEQRNATGIVPGSRHLVLERCRDEIGDWRIILHSPYGRRVHEPWALAIAGRIHALWGADASVVASDDGIVARIPDTDGKL 749 
291282785  670 DEQRNATGIVPGSRHLVLERCRDEIGDWRIILHSPYGRRVHEPWALAIAGRIHALWGADASVVASDDGIVARIPDTDGKL 749 
162148456  721 PGAELFLFDPDKLRGIVTEAVGGSALFAARFRECAARALLLPRRTPGRRSPLWQQRLRAGQLLEIVRDHPDFPILIETAR 800 
15802067   750 PDAAIFLFEPEKLLQIVREAVGSSALFAARFRECAARALLMPGRTPGHRTPLWQQRLRASQLLEIAQGYPDFPAILETLR 829 
15831616   750 PDAAIFLFEPEKLLQIVREAVGSSALFAARFRECAARALLMPGRTPGHRTPLWQQRLRASQLLEIAQGYPDFPAILETLR 829 
209398820  750 PDAAIFLFEPEKLLQIVREAVGSSALFAARFRECAARALLMPGRTPGHRTPLWQQRLRASQLLEIAQGYPDFPAILETLR 829 
254793270  750 PDAAIFLFEPEKLLQIVREAVGSSALFAARFRECAARALLMPGRTPGHRTPLWQQRLRASQLLEIAQGYPDFPAILETLR 829 
253773388  750 PDAAIFLFEPEKLLQIVREAVGSSALFAARFRECAARALLMPGRTPGHRTPLWQQRLRASQLLEIAQGYPDFPVILETLR 829 
254161715  750 PDAAIFLFEPEKLLQIVREAVGSSALFAARFRECAARALLMPGRTPGHRTPLWQQRLRASQLLEIAQGYPDFPVILETLR 829 
218699779  750 PDAAIFLFEPEKLLQIVREAVGSSALFAARFRECAARALLMPGRTPGHRTPLWQQRLRASQLLEIAQGYPDFPVILETLR 829 
218705153  750 PDAAIFLFEPEKLLQIVREAVGSSALFAARFRECAARALLMPGRTPGHRTPLWQQRLRASQLLEIAQGYPDFPVILETLR 829 
291282785  750 PDAAIFLFEPEKLLQIVREAVGSSALFAARFRECAARALLMPGRTPGHRTPLWQQRLRASQLLEIAQGYPDFPAILETLR 829 
162148456  801 ECLQDVYDLAALDGLARRLADGAVRIVEVTTEIPSPFAADLLFGYVGEFMYATDAPIAERRASVLSLDSGLLADLLGEVD 880 
15802067   830 ECLQDVYDLPALERLMRRLNGGEIQISDVTTTTPSPFATSLLFGYVAEFMYQSDAPLAERRASVLSLDSELLRNLLGQVD 909 
15831616   830 ECLQDVYDLPALERLMRRLNGGEIQISDVTTTTPSPFATSLLFGYVAEFMYQSDAPLAERRASVLSLDSELLRNLLGQVD 909 
209398820  830 ECLQDVYDLPALERLMRRLNGGEIQISDVTTTTPSPFATSLLFGYVAEFMYQSDAPLAERRASVLSLDSELLRNLLGQVD 909 
254793270  830 ECLQDVYDLPALERLMRRLNGGEIQISDVTTTTPSPFATSLLFGYVAEFMYQSDAPLAERRASVLSLDSELLRNLLGQVD 909 
253773388  830 ECLQDVYDLPALERLMRRLNGGEIQISDVTTTTPSPFATSLLFGYVAEFMYQSDAPLAERRASVLSLDSELLRNLLGQVD 909 
254161715  830 ECLQDVYDLPALERLMRRLNGGEIQISDVTTTTPSPFATSLLFGYVAEFMYQSDAPLAERRASVLSLDSELLRNLLGQVD 909 
218699779  830 ECLQDVYDLPALERLMRRLNGGEIQISDVTTTTPSPFAASLLFGYVAEFMYQSDAPLAERRASVLSLDSELLRNLLGQVE 909 
218705153  830 ECLQDVYDLPALERLMRRLNGGEIQISDVTTTTPSPFAASLLFGYVAEFMYQSDAPLAERRASVLSLDSELLRNLLGQVD 909 
291282785  830 ECLQDVYDLPALERLMRRLNGGEIQISDVTTTTPSPFATSLLFGYVAEFMYQSDAPLAERRASVLSLDSELLRNLLGQVD 909 
162148456  881 LGTLLDPIIIDQVESELQRLAPARRAKGKEGVADLVRELGPLSTQEIARRLAD--GDAEACLAALVAERRVIPVAMAGRP 958 
15802067   910 PGELLDPQVIRQVEEELQRLAPGRRAKGEEGLFDLLRELGPMTVEDLAQRHTGssEEIASYLENLLTVKRIFPTMISGQE 989 
15831616   910 PGELLDPQVIRQVEEELQRLAPGRRAKGEEGLFDLLRELGPMTVEDLAQRHTGssEEIASYLENLLTVKRIFPTMISGQE 989 
209398820  910 PGELLDPQVIRQVEEELQRLAPGRRAKGEEGLFDLLRELGPMTVEDLAQRHTGssEEIASYLENLLTVKRIFPTMISGQE 989 
254793270  910 PGELLDPQVIRQVEEELQRLAPGRRAKGEEGLFDLLRELGPMTVEDLAQRHTGssEEIASYLENLLTVKRIFPTMISGQE 989 
253773388  910 PGELLDPQVIRQVEEELQRLAPGRRAKGEEGLFDLLRELGPMTVEDLAQRHTGssEEVASYLENLLAVKRIFPAMISGQE 989 
254161715  910 PGELLDPQVIRQVEEELQRLAPGRRAKGEEGLFDLLRELGPMTVEDLAQRHTGssEEVASYLENLLAVKRIFPAMISGQE 989 
218699779  910 PGELLDPQVIRQVEEELQRLAPGRRAKGEEGLFDLLRELGPMTVEDLAQRHTGssEEIASYLENLLAVKRIFPTMISGQE 989 
218705153  910 PGELLDPQVIRQVEEELQRLAPGRRAKGEEGLFDLLRELGPMTVEDLAQRHTGssGEIASYLENLLAVKRIFPTMISGQE 989 
291282785  910 PGELLDPQVIRQVEEELQRLAPGRRAKGEEGLFDLLRELGPMTVEDLAQRHTGssEEIASYLENLLTVKRIFPTMISGQE 989 
162148456  959 CWAAIEDAGRLRDALGMTLPPALPGIFLQPVPDPLRDLFARYARTHGAFTTNAVAARFGLGVTVADTALEGLREQGKLLK 1038
15802067   990 RLACMDDAARLRDALGVRLPESLPEIYLHRVSYPLRDLFLRYLRAHALVTAEQLAHEFSLGIAIVEEQLQQLREQGLVMN 1069
15831616   990 RLACMDDAARLRDALGVRLPESLPEIYLHRVSYPLRDLFLRYLRAHALVTAEQLAHEFSLGIAIVEEQLQQLREQGLVMN 1069
209398820  990 RLACMDDAARLRDALGVRLPESLPEIYLHRVSYPLRDLFLRYLRAHALVTAEQLAHEFSLGIAIVEEQLQQLREQGLVMN 1069
254793270  990 RLACMDDAARLRDALGVRLPESLPEIYLHRVSYPLRDLFLRYLRAHALVTAEQLAHEFSLGIAIVEEQLQQLREQGLVMN 1069
253773388  990 RLACMDDAARLRDALGVRLPESLPEIYLHRVSYPLRDLFLRYLRAHALVTAEQLAHEFSLGIAIVEEQLQQLREQGLVMN 1069
254161715  990 RLACMDDAARLRDALGVRLPESLPEIYLHRVSYPLRDLFLRYLRAHALVTAEQLAHEFSLGIAIVEEQLQQLREQGLVMN 1069
218699779  990 RLACMDDAARLRDALGVRLPESLPEIYLHRVSYPLRDLFLRYLRAHALVTAEQLAHEFSLGIAIVEEQLQQLREQGLVMN 1069
218705153  990 RLACMDDAARLRDALGVRLPESLPEIYLHRVSYPLRDLFLRYLRAHALVTSEQLAHEFSLGIAIVEEQLQQLREQGLVMN 1069
291282785  990 RLACMDDAARLRDALGVRLPESLPEIYLHRVSYPLRDLFLRYLRAHALVTAEQLAHEFSLGIAIVEEQLQQLREQGLVMN 1069
162148456 1039 gnfgverrleawdestgvdpvpsnpLARHEWVADDVFRRLRLRSLQAAREATRPACREAYVHLLLERHGLVAESVGQPAL 1118
15802067  1070 -------------------------LQQDIWVSDEVFRRLRLRSLQAAREATRPVAATTYARLLLERQGVLPATDGSPAL 1124
15831616  1070 -------------------------LQQDIWVSDEVFRRLRLRSLQAAREATRPVAATTYARLLLERQGVLPATDGSPAL 1124
209398820 1070 -------------------------LQQDIWVSDEVFRRLRLRSLQAAREATRPVAATTYARLLLERQGVLPATDGSPAL 1124
254793270 1070 -------------------------LQQDIWVSDEVFRRLRLRSLQAAREATRPVAATTYARLLLERQGVLPATDGSPAL 1124
253773388 1070 -------------------------LQQDIWVSDEVFRRLRLRSLQAAREATRPVAATTYARLLLERQGVLPATDGSPAL 1124
254161715 1070 -------------------------LQQDIWVSDEVFRRLRLRSLQAAREATRPVAATTYARLLLERQGVLPATDGSPAL 1124
218699779 1070 -------------------------LQQDIWVSDEVFRRLRLRSLQAAREATRPVAATTYARLLLERQGVLPATDGSPAL 1124
218705153 1070 -------------------------LQQDIWVSDEVFRRLRLRSLQAAREATRPVAATTYARLLLERQGVLPATDGSPAL 1124
291282785 1070 -------------------------LQQDIWVSDEVFRRLRLRSLQAAREATRPVAATTYARLLLERQGVLPATDGSPAL 1124
162148456 1119 HSpPMTGGMFTGIDGLARAIEQLAGVPLPASLWESQILGARVHHYISAMLDELIALGAVLWCGHGRLGGEDGLVSLHPRD 1198
15802067  1125 FA-STSPGVYEGVDGVMRVIEQLAGVGLPASLWESQILPARVHDYSPEVLDELLATGAVIWSGQKKLGEDDGLVALHLQE 1203
15831616  1125 FA-STSPGVYEGVDGVMRVIEQLAGVGLPASLWESQILPARVHDYSPEVLDELLATGAVIWSGQKKLGEDDGLVALHLQE 1203
209398820 1125 FA-STSPGVYEGVDGVMRVIEQLAGVGLPASLWESQILPARVHDYSPEVLDELLATGAVIWSGQKKLGEDDGLVALHLQE 1203
254793270 1125 FA-STSPGVYEGVDGVMRVIEQLAGVGLPASLWESQILPARVHDYSPEVLDELLATGAVIWSGQKKLGEDDGLVALHLQE 1203
253773388 1125 FA-STSPGVYEGVDGVMRVIEQLAGVGLPASLWESQILPARVRDYSSEMLDELLATGAVIWSGQKKLGEDDGLVALHLQE 1203
254161715 1125 FA-STSPGVYEGVDGVMRVIEQLAGVGLPASLWESQILPARVRDYSSEMLDELLATGAVIWSGQKKLGEDDGLVALHLQE 1203
218699779 1125 FA-STSPGVYEGVDGVMRVIEQLAGVGLPASLWESQILPARVRDYSPEMLDELLATGAVIWSGQKKLGEDDGLVALHLQE 1203
218705153 1125 FA-STSPGVYEGVDGVMRVIEQLAGVGLPASLWESQILPARVRDYSPEMLDELLATGAVIWSGQKKLGEDDGLVALHLQE 1203
291282785 1125 FA-STSPGVYEGVDGVMRVIEQLAGVGLPASLWESQILPARVHDYSPEVLDELLATGAVIWSEQKKLGEDDGLVALHLQE 1203
162148456 1199 FAAETLPPPPdaDDMAALSPLQRSILDVLADGGAYFARQLATLATVRLTEEpagtwdgdpmVSASDLDTALWDLAWAGYV 1278
15802067  1204 YAAESFTPAE--ADQANRSALQQAIVAVLADGGAWFAQQISQRIRDKIGES----------VDPSALQEALWALVWQGVI 1271
15831616  1204 YAAESFTPAE--ADQANRSALQQAIVAVLADGGAWFAQQISQRIRDKIGES----------VDPSALQEALWALVWQGVI 1271
209398820 1204 YAAESFTPAE--ADQANRSALQQAIVAVLADGGAWFAQQISQRIRDKIGES----------VDPSALQEALWALVWQGVI 1271
254793270 1204 YAAESFTPAE--ADQANRSALQQAIVAVLADGGAWFAQQISQRIRDKIGES----------VDPSALQEALWALVWQGVI 1271
253773388 1204 YAAESFTPAE--ADQANRSALQQAIVAVLADGGAWFAQQISQRIRDKIGES----------VDLSALQEALWALVWQGVI 1271
254161715 1204 YAAESFTPAE--ADQANRSALQQAIVAVLADGGAWFAQQISQRIRDKIGES----------VDLSALQEALWALVWQGVI 1271
218699779 1204 YAAETFTPAE--ADQANRSALQQAIIAVLADGGAWFAQQISQRIRDKIGES----------VDPSALQEALWALVWQGVI 1271
218705153 1204 YAAESFTSAE--ADQANRSALQQAIIAVLADGGAWFAQQISQRIRDKIGES----------VDPSALQEALWALVWQGVI 1271
291282785 1204 YAAESFTPAE--ADQANRSALQQAIVAVLADGGAWFAQQISQRIRDKIGES----------VDPSALQEALWALVWQGVI 1271
162148456 1279 TSDSWAPLRARAGARAAHRPRPVSLSRRRRGLRGFPSFAqPGTGARGDPTLAGRWSLLPREPASDTARALALVEGLLDRY 1358
15802067  1272 TSDIWAPLRALTRSSSNARTSTRRSHRARRGRPVYAQPV-SPRVSYNTPNLAGRWSLLQVEPLNDTERMLALAENMLDRY 1350
15831616  1272 TSDIWAPLRALTRSSSNARTSTRRSHRARRGRPVYAQPV-SPRVSYNTPNLAGRWSLLQVEPLNDTERMLALAENMLDRY 1350
209398820 1272 TSDIWAPLRALTRSSSNARTSTRRSHRARRGRPVYAQPV-SPRVSYNTPNLAGRWSLLQVEPLNDTERMLALAENMLDRY 1350
254793270 1272 TSDIWAPLRALTRSSSNARTSTRRSHRARRGRPVYAQPV-SPRVSYNTPNLAGRWSLLQVEPLNDTERMLALAENMLDRY 1350
253773388 1272 TSDIWAPLRALTRSSSNARTSTRRSHRARRGRPVYAQPV-SPRVSYNTPNLAGRWSLLQVEPLNDTERMLALAENMLDRY 1350
254161715 1272 TSDIWAPLRALTRSSSNARTSTRRSHRARRGRPVYAQPV-SPRVSYNTPNLAGRWSLLQVEPLNDTERMLALAENMLDRY 1350
218699779 1272 TSDIWAPLRALTRSSSNARTSTRRSHRARRGRPVYAQPV-SPRVSYNTPKLAGRWSLLQVEPLNDTERMLALAENMLDRY 1350
218705153 1272 TSDIWAPLRALTRSSSNARTSTRRSHRARRGRPVYAQPV-SPRVSYNTPNLAGRWSLLQVEPLNDTERMLALAENMLDRY 1350
291282785 1272 TSDIWAPLRALTRSSSNARTSTRRSHRARRGRPVYAQPV-SPRVSYNTPNLAGRWSLLQVEPLNDTERMLALAENMLDRY 1350
162148456 1359 GIVTRGAAVAEDVPGGFPALQPIFRSMEDAGQILRGRFVEGLGASQFAERATVDRLRELAGRRTTDP--TPVALSAADPA 1436
15802067  1351 GIISRQAVIAENIPGGFPSMQTLCRSMEDSGRIMRGRFVEGLGGAQFAERLTIDRLRDLATQAAQTRhyTPVALSANDPA 1430
15831616  1351 GIISRQAVIAENIPGGFPSMQTLCRSMEDSGRIMRGRFVEGLGGAQFAERLTIDRLRDLATQAAQTRhyTPVALSANDPA 1430
209398820 1351 GIISRQAVIAENIPGGFPSMQTLCRSMEDSGRIMRGRFVEGLGGAQFAERLTIDRLRDLATQAAQTRhyTPVALSANDPA 1430
254793270 1351 GIISRQAVIAENIPGGFPSMQTLCRSMEDSGRIMRGRFVEGLGGAQFAERLTIDRLRDLATQAAQTRhyTPVALSANDPA 1430
253773388 1351 GIISRQAVIAENIPGGFPSMQTLCRSMEDSGRIMRGRFVEGLGGAQFAERLTIDRLRDLATQATQTRhyTPVALSANDPA 1430
254161715 1351 GIISRQAVIAENIPGGFPSMQTLCRSMEDSGRIMRGRFVEGLGGAQFAERLTIDRLRDLATQATQTRhyTPVALSANDPA 1430
218699779 1351 GIISRQAVIAENIPGGFPSMQTLCRSMEDSGRIMRGRFVEGLGGAQFAERLTIDRLRDLATQTAQTRhyTPVALSANDPA 1430
218705153 1351 GIISRQAVIAENIPGGFPSMQTLCRSMEDSGRIMRGRFVEGLGGAQFAERLTIDRLRDLATQATQTRhyTPVALSANDPA 1430
291282785 1351 GIISRQAVIAENIPGGFPSMQTLCRSMEDSGRIMRGRFVEGLGGAQFAERLTIDRLRDLATQAAQTRhyTPVALSANDPA 1430
162148456 1437 NPFGTILPWPSHPSAMRPTRRGGAFVVIAGGHLVLYLTQGGRTLLTYIDADDPAHAGMLGAslasLAATLRREKHLMFTL 1516
15802067  1431 NVWGNLLPWPAHPATLVPTRRAGALVVVSGGKLLLYLAQGGKKMLVWQEKEELLAPEVFHA----LTTALRREPRLRFTL 1506
15831616  1431 NVWGNLLPWPAHPATLVPTRRAGALVVVSGGKLLLYLAQGGKKMLVWQEKEELLAPEVFHA----LTTALRREPRLRFTL 1506
209398820 1431 NVWGNLLPWPAHPATLVPTRRAGALVVVSGGKLLLYLAQGGKKMLVWQEKEELLAPEVFHA----LTTALRREPRLRFTL 1506
254793270 1431 NVWGNLLPWPAHPATLVPTRRAGALVVVSGGKLLLYLAQGGKKMLVWQEKEELLAPEVFHA----LTTALRREPRLRFTL 1506
253773388 1431 NVWGNLLPWPAHPATLVPTRRAGALVVVSGGKLLLYLAQGGKKMLVWQEKEELLAPEVFHA----LTTALRREPRLRFTL 1506
254161715 1431 NVWGNLLPWPAHPATLVPTRRAGALVVVSGGKLLLYLAQGGKKMLVWQEKEELLAPEVFHA----LTTALRREPRLRFTL 1506
218699779 1431 NVWGNLLPWPAHPATLVPTRRAGALVVVSGGKLLLYLAQGGKKMLVWQEKEELLAPEVFHA----LTTALRREPRLRFTL 1506
218705153 1431 NVWGNLLPWPAHPATLVPTRRAGALVVVSGGKLLLYLAQGGKKMLVWQEKDELLAPEIFQA----LTTALRREPRLRFTL 1506
291282785 1431 NVWGNLLPWPAHPATLVPTRRAGALVVVSGGKLLLYLAQGGKKMLVWQEKEELLAPEVFHA----LTTALRREPRLRFTL 1506
162148456 1517 ETVNERPVRTTSLDTALRACGFSLVPKGLSWH 1548
15802067  1507 TEVNDLPVWQTPMFTLLREAGFSSSPQGLDWG 1538
15831616  1507 TEVNDLPVWQTPMFTLLREAGFSSSPQGLDWG 1538
209398820 1507 TEVNDLPVWQTPMFTLLREAGFSSSPQGLDWG 1538
254793270 1507 TEVNDLPVWQTPMFTLLREAGFSSSPQGLDWG 1538
253773388 1507 TEVNDLPVRQTPMFTLLREAGFSSSPQGLDWG 1538
254161715 1507 TEVNDLPVRQTPMFTLLREAGFSSSPQGLDWG 1538
218699779 1507 TEVNDLPVRQTPMFTLLREAGFSSSPQGLDWE 1538
218705153 1507 TEVNDLPVRQTPMFTLLREAGFSSSPQGLDWG 1538
291282785 1507 TEVNDLPVWQTPMFTLLREAGFSSSPQGLDWG 1538
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap