Conserved Protein Domain Family
PRK09744

?
PRK09744: PRK09744 
DNA-binding transcriptional regulator DicC; Provisional
Statistics
?
PSSM-Id: 137503
View PSSM: PRK09744
Aligned: 33 rows
Threshold Bit Score: 144.721
Threshold Setting Gi: 218705069
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16129528   1 MLKTDALLYFGSKTKLAQAAGIRLASLYSWkGDLVPEGRAMRLQEASGGELQYDPKVYDEYRKTKRAGRLNNENHS 76 
170682538  1 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-GELVPEGRAMRLQEASGGELQYDPKVYDEYRKAKRAGRLNNENHP 75 
209400538  1 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-GELVPEGRAMRLQEASGGELQYDPKVYDEYRKAKRAGRLNNENHP 75 
209396753  1 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-GELVPEGRAMRLQEASGGELQYDPKVYDEYRKAKRAGRLNNENHP 75 
215486345  1 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-GELVPEGRAMRLQEASGGELQYDPKVYDEYRKAKRAGRLNNENHP 75 
260843555  1 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-GELVPEGRAMRLQEASGGELQYDPKVYDEYRKAKRAGRLNNENHP 75 
260855309  1 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-QELVPEGRAMRLQEASGGELLYDPKVYDEYRKTKRAGRLNNENHS 75 
260868063  1 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-QELVPEGRAMRLQEASGGELLYDPKVYDEYRKTKRAGRLNNENHS 75 
218705069 10 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-QELVPEGRAMRLQEASGGELLYDPKVYDEYRKTKRAGRLNNENHS 84 
218694782 10 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-QELVPEGRAMRLQEASGGELLYDPKVYDEYRKTKRAGRLNNENHS 84 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap